BLASTX nr result
ID: Dioscorea21_contig00029030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00029030 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK04547.1| predicted protein [Hordeum vulgare subsp. vulgare] 69 5e-10 ref|XP_002436771.1| hypothetical protein SORBIDRAFT_10g008490 [S... 69 5e-10 ref|NP_001146539.1| nucleic acid binding protein [Zea mays] gi|2... 69 5e-10 gb|ACG33609.1| nucleic acid binding protein [Zea mays] 69 5e-10 ref|NP_001057246.2| Os06g0237100 [Oryza sativa Japonica Group] g... 68 7e-10 >dbj|BAK04547.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 209 Score = 68.6 bits (166), Expect = 5e-10 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +3 Query: 3 YDYIAKRRYAWFGKDDKCLVMHDKDLLDRFIDREELFGDWDEN 131 YDYIA+ RY WFGKDD+CLV D++LL+RFIDR+E+ GD N Sbjct: 164 YDYIARNRYDWFGKDDECLVTKDRELLERFIDRDEMLGDGPSN 206 >ref|XP_002436771.1| hypothetical protein SORBIDRAFT_10g008490 [Sorghum bicolor] gi|241914994|gb|EER88138.1| hypothetical protein SORBIDRAFT_10g008490 [Sorghum bicolor] Length = 219 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 3 YDYIAKRRYAWFGKDDKCLVMHDKDLLDRFIDREELFGDWDEN*LF 140 YDYIAK RY WFGKDD+C+V DK++L+RFIDREE+ G N F Sbjct: 174 YDYIAKNRYDWFGKDDECIVTKDKEILERFIDREEMLGGGPSNSFF 219 >ref|NP_001146539.1| nucleic acid binding protein [Zea mays] gi|219887741|gb|ACL54245.1| unknown [Zea mays] gi|413952552|gb|AFW85201.1| nucleic acid binding protein [Zea mays] Length = 211 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 3 YDYIAKRRYAWFGKDDKCLVMHDKDLLDRFIDREELFGDWDEN*LF 140 YDYIAK RY WFGKDD+C+V DK++L+RFIDREE+ G N F Sbjct: 166 YDYIAKNRYDWFGKDDECIVTKDKEILERFIDREEMLGGGPSNSFF 211 >gb|ACG33609.1| nucleic acid binding protein [Zea mays] Length = 211 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 3 YDYIAKRRYAWFGKDDKCLVMHDKDLLDRFIDREELFGDWDEN*LF 140 YDYIAK RY WFGKDD+C+V DK++L+RFIDREE+ G N F Sbjct: 166 YDYIAKNRYDWFGKDDECIVTKDKEILERFIDREEMLGGGPSNSFF 211 >ref|NP_001057246.2| Os06g0237100 [Oryza sativa Japonica Group] gi|255676871|dbj|BAF19160.2| Os06g0237100 [Oryza sativa Japonica Group] Length = 215 Score = 68.2 bits (165), Expect = 7e-10 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +3 Query: 3 YDYIAKRRYAWFGKDDKCLVMHDKDLLDRFIDREELFGD 119 YDYIAK RY WFGKDD+C+V +K+LL+RFIDREE+ GD Sbjct: 165 YDYIAKNRYDWFGKDDECIVTKNKELLERFIDREEMLGD 203