BLASTX nr result
ID: Dioscorea21_contig00028061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00028061 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143689.1| PREDICTED: elongator complex protein 6-like ... 55 8e-06 >ref|XP_004143689.1| PREDICTED: elongator complex protein 6-like [Cucumis sativus] Length = 260 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = +3 Query: 54 MSSNVSNLLEEALXXXXXXXXXXXVVLVEDCVETSGAFVLHHLMKRVLS 200 M SNLL+EA+ ++LVEDCVETSGAFVLHHL+KR S Sbjct: 1 MDRMTSNLLDEAIGFDDPTPLIGRLLLVEDCVETSGAFVLHHLLKRAFS 49