BLASTX nr result
ID: Dioscorea21_contig00027918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027918 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551594.1| PREDICTED: ADP-ribosylation factor-binding p... 130 1e-28 ref|XP_003533672.1| PREDICTED: TOM1-like protein 2-like [Glycine... 125 5e-27 ref|XP_002440893.1| hypothetical protein SORBIDRAFT_09g015260 [S... 125 5e-27 ref|XP_003623549.1| Class E vacuolar protein-sorting machinery p... 124 8e-27 gb|AFW77795.1| putative VHS/GAT domain containing family protein... 124 1e-26 >ref|XP_003551594.1| PREDICTED: ADP-ribosylation factor-binding protein GGA1-like [Glycine max] Length = 740 Score = 130 bits (326), Expect = 1e-28 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = +1 Query: 1 LLETMIKNCGDSVHHQVAERDILQEMIKIVRKKTDMQVRDKILVLLDSWQEAFGGPGGKY 180 LLETM+KNCGD VH Q+AER+IL+EMIKIVRKK DMQVRDKIL+LLDSWQEAFGGPGGK+ Sbjct: 68 LLETMVKNCGDYVHFQIAERNILEEMIKIVRKKADMQVRDKILILLDSWQEAFGGPGGKH 127 Query: 181 PQYFLAYSELKR 216 PQY+ AY ELKR Sbjct: 128 PQYYWAYEELKR 139 >ref|XP_003533672.1| PREDICTED: TOM1-like protein 2-like [Glycine max] Length = 529 Score = 125 bits (313), Expect = 5e-27 Identities = 58/72 (80%), Positives = 65/72 (90%) Frame = +1 Query: 1 LLETMIKNCGDSVHHQVAERDILQEMIKIVRKKTDMQVRDKILVLLDSWQEAFGGPGGKY 180 LLETM+KNCGD VH Q+AER+IL+EMIKIVRKK DMQVRDKIL+LLDSWQEAFGGPGGK+ Sbjct: 68 LLETMVKNCGDYVHFQIAERNILEEMIKIVRKKADMQVRDKILILLDSWQEAFGGPGGKH 127 Query: 181 PQYFLAYSELKR 216 Y+ AY ELKR Sbjct: 128 SHYYWAYEELKR 139 >ref|XP_002440893.1| hypothetical protein SORBIDRAFT_09g015260 [Sorghum bicolor] gi|241946178|gb|EES19323.1| hypothetical protein SORBIDRAFT_09g015260 [Sorghum bicolor] Length = 583 Score = 125 bits (313), Expect = 5e-27 Identities = 58/72 (80%), Positives = 66/72 (91%) Frame = +1 Query: 1 LLETMIKNCGDSVHHQVAERDILQEMIKIVRKKTDMQVRDKILVLLDSWQEAFGGPGGKY 180 LLET+IKNCGD VH QV ER+IL+EMIKIV+KK DMQVRDKIL+LLDSWQEAFGGPGGK+ Sbjct: 61 LLETLIKNCGDHVHFQVVERNILEEMIKIVKKKADMQVRDKILMLLDSWQEAFGGPGGKH 120 Query: 181 PQYFLAYSELKR 216 P Y+ AY+ELKR Sbjct: 121 PHYYWAYAELKR 132 >ref|XP_003623549.1| Class E vacuolar protein-sorting machinery protein HSE1 [Medicago truncatula] gi|355498564|gb|AES79767.1| Class E vacuolar protein-sorting machinery protein HSE1 [Medicago truncatula] Length = 731 Score = 124 bits (311), Expect = 8e-27 Identities = 58/72 (80%), Positives = 63/72 (87%) Frame = +1 Query: 1 LLETMIKNCGDSVHHQVAERDILQEMIKIVRKKTDMQVRDKILVLLDSWQEAFGGPGGKY 180 LLETM+KNCGD VH Q+ +R IL+EMIKIVRKK DMQVRDKIL LLDSWQEAFGG GGKY Sbjct: 69 LLETMVKNCGDYVHFQITDRHILEEMIKIVRKKADMQVRDKILALLDSWQEAFGGAGGKY 128 Query: 181 PQYFLAYSELKR 216 PQY+ AY ELKR Sbjct: 129 PQYYWAYDELKR 140 >gb|AFW77795.1| putative VHS/GAT domain containing family protein [Zea mays] Length = 586 Score = 124 bits (310), Expect = 1e-26 Identities = 56/72 (77%), Positives = 67/72 (93%) Frame = +1 Query: 1 LLETMIKNCGDSVHHQVAERDILQEMIKIVRKKTDMQVRDKILVLLDSWQEAFGGPGGKY 180 LLET+IKNCGD VH+QV ER+IL+EM+KIV+KK DMQVRDKIL+LLDSWQ+AFGGPGGK+ Sbjct: 61 LLETLIKNCGDHVHYQVVERNILEEMMKIVKKKADMQVRDKILMLLDSWQDAFGGPGGKH 120 Query: 181 PQYFLAYSELKR 216 P Y+ AY+ELKR Sbjct: 121 PHYYWAYAELKR 132