BLASTX nr result
ID: Dioscorea21_contig00027798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027798 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281558.1| PREDICTED: pentatricopeptide repeat-containi... 164 7e-39 ref|XP_004138309.1| PREDICTED: pentatricopeptide repeat-containi... 144 7e-33 ref|XP_004155057.1| PREDICTED: pentatricopeptide repeat-containi... 142 3e-32 gb|AEP33769.1| organelle transcript processing 82, partial [Olim... 133 2e-29 ref|NP_172286.1| pentatricopeptide repeat-containing protein [Ar... 131 5e-29 >ref|XP_002281558.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980 [Vitis vinifera] gi|297733922|emb|CBI15169.3| unnamed protein product [Vitis vinifera] Length = 615 Score = 164 bits (415), Expect = 7e-39 Identities = 78/121 (64%), Positives = 101/121 (83%) Frame = +2 Query: 8 LLQLEPENAENYVLLANILVRDQRWNEIGKVRAMLNQRRIKKVPGCSSIEIDNVVYEFVA 187 LL+LEP N ENYVLLAN+ RDQRW+++G+VR M++ RR++KVPGCSSIEIDNVVYEFV Sbjct: 438 LLELEPNNGENYVLLANLYARDQRWDKVGEVREMMDCRRVRKVPGCSSIEIDNVVYEFV- 496 Query: 188 ASRFEKETMDEIYYMLEEVGRKLKVAGYVADTELVSYDLVEEEKEETLMHHSEKLALAFG 367 S + K +E+Y +L ++ +KLK+AGYVADT + SYD+ EEEKE +LM+HSEKLALAFG Sbjct: 497 VSNYIKPGFEEVYKLLADMNKKLKLAGYVADTGMASYDIEEEEKEHSLMYHSEKLALAFG 556 Query: 368 M 370 + Sbjct: 557 L 557 >ref|XP_004138309.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 562 Score = 144 bits (363), Expect = 7e-33 Identities = 71/121 (58%), Positives = 93/121 (76%) Frame = +2 Query: 8 LLQLEPENAENYVLLANILVRDQRWNEIGKVRAMLNQRRIKKVPGCSSIEIDNVVYEFVA 187 L++LEP N ENYVLL+NI R++RW E+GK+R M+N R I+KVPGCSSIEI+NVVYEFV Sbjct: 385 LIELEPNNGENYVLLSNIYSRERRWAEVGKLRGMMNLRGIRKVPGCSSIEINNVVYEFV- 443 Query: 188 ASRFEKETMDEIYYMLEEVGRKLKVAGYVADTELVSYDLVEEEKEETLMHHSEKLALAFG 367 AS K + IY L+ + +KLK GYV T++ YD+ +EEKE ++M+HSEKLALAFG Sbjct: 444 ASNDRKPEFEAIYKQLDNLIKKLKENGYVTGTDMALYDIEKEEKEHSVMYHSEKLALAFG 503 Query: 368 M 370 + Sbjct: 504 L 504 >ref|XP_004155057.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 562 Score = 142 bits (358), Expect = 3e-32 Identities = 70/121 (57%), Positives = 93/121 (76%) Frame = +2 Query: 8 LLQLEPENAENYVLLANILVRDQRWNEIGKVRAMLNQRRIKKVPGCSSIEIDNVVYEFVA 187 L++LEP N ENYVLL+NI R++RW E+GK+R M++ R I+KVPGCSSIEI+NVVYEFV Sbjct: 385 LIELEPNNGENYVLLSNIYSRERRWAEVGKLRGMMSLRGIRKVPGCSSIEINNVVYEFV- 443 Query: 188 ASRFEKETMDEIYYMLEEVGRKLKVAGYVADTELVSYDLVEEEKEETLMHHSEKLALAFG 367 AS K + IY L+ + +KLK GYV T++ YD+ +EEKE ++M+HSEKLALAFG Sbjct: 444 ASNDRKPEFEAIYKQLDNLIKKLKENGYVTGTDMALYDIEKEEKEHSVMYHSEKLALAFG 503 Query: 368 M 370 + Sbjct: 504 L 504 >gb|AEP33769.1| organelle transcript processing 82, partial [Olimarabidopsis pumila] Length = 710 Score = 133 bits (334), Expect = 2e-29 Identities = 67/122 (54%), Positives = 88/122 (72%) Frame = +2 Query: 5 NLLQLEPENAENYVLLANILVRDQRWNEIGKVRAMLNQRRIKKVPGCSSIEIDNVVYEFV 184 NL+++EPEN +YVLL+NI +RWNE+ K RA+LN + +KKVPGCSSIEID+VV+EF+ Sbjct: 532 NLIKIEPENPGSYVLLSNIYATAERWNEVAKTRALLNDKGMKKVPGCSSIEIDSVVHEFI 591 Query: 185 AASRFEKETMDEIYYMLEEVGRKLKVAGYVADTELVSYDLVEEEKEETLMHHSEKLALAF 364 +F EIY MLEE+ L+ AG+V DT V ++ EE KE L HHSEKLA+AF Sbjct: 592 IGDKFHPRNR-EIYGMLEEMEVLLEEAGFVPDTSEVLQEMEEEWKEGALRHHSEKLAIAF 650 Query: 365 GM 370 G+ Sbjct: 651 GL 652 >ref|NP_172286.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75174869|sp|Q9LN01.1|PPR21_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g08070 gi|8778839|gb|AAF79838.1|AC026875_18 T6D22.15 [Arabidopsis thaliana] gi|332190118|gb|AEE28239.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 741 Score = 131 bits (330), Expect = 5e-29 Identities = 67/122 (54%), Positives = 87/122 (71%) Frame = +2 Query: 5 NLLQLEPENAENYVLLANILVRDQRWNEIGKVRAMLNQRRIKKVPGCSSIEIDNVVYEFV 184 NL+++EPEN +YVLL+NI RWNE+ K RA+LN + +KKVPGCSSIEID+VV+EF+ Sbjct: 563 NLIKIEPENPGSYVLLSNIYASAGRWNEVAKTRALLNDKGMKKVPGCSSIEIDSVVHEFI 622 Query: 185 AASRFEKETMDEIYYMLEEVGRKLKVAGYVADTELVSYDLVEEEKEETLMHHSEKLALAF 364 +F EIY MLEE+ L+ AG+V DT V ++ EE KE L HHSEKLA+AF Sbjct: 623 IGDKFHPRNR-EIYGMLEEMEVLLEKAGFVPDTSEVLQEMEEEWKEGALRHHSEKLAIAF 681 Query: 365 GM 370 G+ Sbjct: 682 GL 683