BLASTX nr result
ID: Dioscorea21_contig00027730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027730 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29439.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002271813.1| PREDICTED: uncharacterized protein LOC100249... 56 3e-06 >emb|CBI29439.3| unnamed protein product [Vitis vinifera] Length = 794 Score = 55.8 bits (133), Expect = 3e-06 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 8/63 (12%) Frame = -3 Query: 167 MATSAFKSTTKRSSNG--------GAVDHRRSRSLSRGPDRFPPASRAVDSAELPNPRGR 12 MATSAFKSTTKRSS G + HRRSRSLSR R PA+ D E+P P+GR Sbjct: 223 MATSAFKSTTKRSSIGTPSRAGTSSSSAHRRSRSLSRF-SRKVPAAEEEDFEEVPVPKGR 281 Query: 11 FVN 3 FVN Sbjct: 282 FVN 284 >ref|XP_002271813.1| PREDICTED: uncharacterized protein LOC100249354 [Vitis vinifera] Length = 572 Score = 55.8 bits (133), Expect = 3e-06 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 8/63 (12%) Frame = -3 Query: 167 MATSAFKSTTKRSSNG--------GAVDHRRSRSLSRGPDRFPPASRAVDSAELPNPRGR 12 MATSAFKSTTKRSS G + HRRSRSLSR R PA+ D E+P P+GR Sbjct: 1 MATSAFKSTTKRSSIGTPSRAGTSSSSAHRRSRSLSRF-SRKVPAAEEEDFEEVPVPKGR 59 Query: 11 FVN 3 FVN Sbjct: 60 FVN 62