BLASTX nr result
ID: Dioscorea21_contig00027515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027515 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01923.1| hypothetical protein [Beta vulgaris] 61 8e-08 emb|CAN79116.1| hypothetical protein VITISV_002093 [Vitis vinifera] 61 8e-08 emb|CAN60366.1| hypothetical protein VITISV_031870 [Vitis vinifera] 61 8e-08 gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum ... 61 8e-08 dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] 60 1e-07 >gb|ACY01923.1| hypothetical protein [Beta vulgaris] Length = 572 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = +1 Query: 1 DIAFSVNFLSRFMHKPTKHHVGGAKHILRYLAGSKDFGIFYKRR 132 DIAFSVN L+R+++ PTK H G +H+LRYL G++D G+FY+ R Sbjct: 360 DIAFSVNLLARYINAPTKRHWNGVRHLLRYLRGTQDLGLFYQSR 403 >emb|CAN79116.1| hypothetical protein VITISV_002093 [Vitis vinifera] Length = 1109 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +1 Query: 1 DIAFSVNFLSRFMHKPTKHHVGGAKHILRYLAGSKDFGIFY 123 DIAF+V +SRFMH P+K H+G AK +LRY+AG+ DFGI+Y Sbjct: 931 DIAFAVEVISRFMHCPSKQHLGAAKRLLRYIAGTYDFGIWY 971 >emb|CAN60366.1| hypothetical protein VITISV_031870 [Vitis vinifera] Length = 1274 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +1 Query: 1 DIAFSVNFLSRFMHKPTKHHVGGAKHILRYLAGSKDFGIFY 123 DIAF+V +SRFMH P+K H+G AK +LRY+AG+ DFGI+Y Sbjct: 1064 DIAFAVGVISRFMHCPSKQHLGAAKRLLRYIAGTYDFGIWY 1104 >gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1333 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 1 DIAFSVNFLSRFMHKPTKHHVGGAKHILRYLAGSKDFGIFYKR 129 DIAFSV+ +SRF+ PTK H G AK +LRY+AG+ DFGI+Y + Sbjct: 1124 DIAFSVSVVSRFLQSPTKQHFGAAKRVLRYVAGTTDFGIWYSK 1166 >dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] Length = 1291 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = +1 Query: 1 DIAFSVNFLSRFMHKPTKHHVGGAKHILRYLAGSKDFGIFYKRRRQCIVQGSS 159 DIAFSVN L+RF PT+ H G KHI RYL G+KD G++++ + + G S Sbjct: 964 DIAFSVNLLARFSASPTRRHWSGVKHIFRYLQGTKDLGLYFENNQDITLMGYS 1016