BLASTX nr result
ID: Dioscorea21_contig00027275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027275 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67204.1| hypothetical protein VITISV_012181 [Vitis vinifera] 60 1e-07 emb|CBI18144.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|NP_001235482.1| disease resistance protein [Glycine max] gi|... 55 8e-06 >emb|CAN67204.1| hypothetical protein VITISV_012181 [Vitis vinifera] Length = 247 Score = 60.5 bits (145), Expect = 1e-07 Identities = 22/40 (55%), Positives = 31/40 (77%) Frame = -2 Query: 235 NWLFIFVELGFIVGLAIVFGSLMLWRSWRTWYFERVDQLL 116 NW++I E+GF+ G+ IV G L+LWR+WR WY+ VD+LL Sbjct: 184 NWVYIGAEIGFVTGIGIVIGPLVLWRTWRRWYYTHVDRLL 223 >emb|CBI18144.3| unnamed protein product [Vitis vinifera] Length = 2134 Score = 59.7 bits (143), Expect = 2e-07 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = -2 Query: 235 NWLFIFVELGFIVGLAIVFGSLMLWRSWRTWYFERVDQLL 116 NW++I E+GF+ G+ IV G L+LWR WR WY+ VD+LL Sbjct: 1228 NWVYIGAEIGFVTGIGIVIGPLVLWRRWRRWYYTHVDRLL 1267 >ref|NP_001235482.1| disease resistance protein [Glycine max] gi|223452508|gb|ACM89581.1| disease resistance protein [Glycine max] Length = 1094 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = -2 Query: 232 WLFIFVELGFIVGLAIVFGSLMLWRSWRTWYFERVDQLL 116 W I VELGF+ GLA+V L+ W+ WR WY++RVD +L Sbjct: 996 WNIIMVELGFVFGLALVIDPLLFWKQWRQWYWKRVDLIL 1034