BLASTX nr result
ID: Dioscorea21_contig00027094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00027094 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB78007.1| putative protein [Arabidopsis thaliana] gi|73210... 55 5e-06 >emb|CAB78007.1| putative protein [Arabidopsis thaliana] gi|7321071|emb|CAB82118.1| putative protein [Arabidopsis thaliana] Length = 404 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/68 (33%), Positives = 39/68 (57%) Frame = -2 Query: 204 LCDGPWTIDGRILRLSEWRESFQPAFEKLSTAAVWIQLHHVPMELWSGDLLENIASHFGR 25 L GPW + G L + +W +F P + + T VW++L ++P+ + LLE IA G+ Sbjct: 80 LTGGPWRVFGNYLMVQDWSPNFDPLRDDIVTTPVWVRLTNIPVNYYHRCLLEEIARGLGK 139 Query: 24 AMKIDEHT 1 +K+D +T Sbjct: 140 LLKVDLNT 147