BLASTX nr result
ID: Dioscorea21_contig00026000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00026000 (494 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280713.1| PREDICTED: probable tRNA threonylcarbamoylad... 84 1e-14 ref|XP_002511688.1| O-sialoglycoprotein endopeptidase, putative ... 79 3e-13 ref|XP_002320052.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|NP_566039.1| glycoprotease 1 [Arabidopsis thaliana] gi|17380... 77 1e-12 ref|XP_003521890.1| PREDICTED: probable tRNA threonylcarbamoylad... 76 2e-12 >ref|XP_002280713.1| PREDICTED: probable tRNA threonylcarbamoyladenosine biosynthesis protein osgepl1 [Vitis vinifera] gi|296089195|emb|CBI38898.3| unnamed protein product [Vitis vinifera] Length = 468 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 2 EPENYLVDLRPRWPLGEEYSQGRSEARSLKRARIHPSLTSIIQGSM 139 EPE+Y+ DLRPRWPLGEEYS+GRSEARSL+ ARIHPSLTS+IQ SM Sbjct: 419 EPEDYVYDLRPRWPLGEEYSEGRSEARSLRTARIHPSLTSLIQASM 464 >ref|XP_002511688.1| O-sialoglycoprotein endopeptidase, putative [Ricinus communis] gi|223548868|gb|EEF50357.1| O-sialoglycoprotein endopeptidase, putative [Ricinus communis] Length = 455 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = +2 Query: 2 EPENYLVDLRPRWPLGEEYSQGRSEARSLKRARIHPSLTSIIQGSM 139 EPE+ + DLRPRWPLGEEY++GRS+ARSLK ARIHPSLTSIIQ S+ Sbjct: 407 EPEDIMYDLRPRWPLGEEYAEGRSKARSLKTARIHPSLTSIIQASL 452 >ref|XP_002320052.1| predicted protein [Populus trichocarpa] gi|222860825|gb|EEE98367.1| predicted protein [Populus trichocarpa] Length = 464 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = +2 Query: 2 EPENYLVDLRPRWPLGEEYSQGRSEARSLKRARIHPSLTSIIQGSM 139 E E+Y+ DLRPRWPLGEEY++GRSEARSL+ ARIHPSLTSIIQ S+ Sbjct: 416 EHEDYMYDLRPRWPLGEEYAEGRSEARSLRTARIHPSLTSIIQASL 461 >ref|NP_566039.1| glycoprotease 1 [Arabidopsis thaliana] gi|17380780|gb|AAL36220.1| putative O-sialoglycoprotein endopeptidase [Arabidopsis thaliana] gi|18460924|gb|AAK00530.1| sialoglycoprotease GCP1 [Arabidopsis thaliana] gi|20196913|gb|AAB82636.2| putative O-sialoglycoprotein endopeptidase [Arabidopsis thaliana] gi|21436377|gb|AAM51358.1| putative O-sialoglycoprotein endopeptidase [Arabidopsis thaliana] gi|330255438|gb|AEC10532.1| glycoprotease 1 [Arabidopsis thaliana] Length = 480 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = +2 Query: 2 EPENYLVDLRPRWPLGEEYSQGRSEARSLKRARIHPSLTSIIQ 130 EPE+Y+ DLRPRWPLGEEY++GRSEARS++ ARIHPSLTSII+ Sbjct: 428 EPEDYVYDLRPRWPLGEEYAKGRSEARSMRTARIHPSLTSIIR 470 >ref|XP_003521890.1| PREDICTED: probable tRNA threonylcarbamoyladenosine biosynthesis protein osgepl1-like [Glycine max] Length = 445 Score = 76.3 bits (186), Expect = 2e-12 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = +2 Query: 2 EPENYLVDLRPRWPLGEEYSQGRSEARSLKRARIHPSLTSIIQGSM 139 EPE+++ D+RPRWPLGEEY++G+S ARSL+ ARIHPSLTSIIQ S+ Sbjct: 398 EPEDFVYDIRPRWPLGEEYAEGKSVARSLRTARIHPSLTSIIQASL 443