BLASTX nr result
ID: Dioscorea21_contig00025924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025924 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002334697.1| nbs-lrr resistance protein [Populus trichoca... 58 7e-07 ref|XP_002304589.1| nbs-lrr resistance protein [Populus trichoca... 57 1e-06 gb|ABV30822.1| NBS-containing resistance-like protein [Platanus ... 56 3e-06 gb|ABV30820.1| NBS-containing resistance-like protein [Platanus ... 56 3e-06 gb|ABV30819.1| NBS-containing resistance-like protein [Platanus ... 56 3e-06 >ref|XP_002334697.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222874531|gb|EEF11662.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 910 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -2 Query: 130 DEELKKVVYEHLKERRYLVVIDDIWTRGAWDNIKEVLPAEMLN 2 DEEL+ +VYE+L+ +RYLVV+DDIW+ AWD +K+ PA+ N Sbjct: 273 DEELEDLVYENLRRKRYLVVLDDIWSTKAWDCLKKAFPADRSN 315 >ref|XP_002304589.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222842021|gb|EEE79568.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 896 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/43 (53%), Positives = 33/43 (76%) Frame = -2 Query: 130 DEELKKVVYEHLKERRYLVVIDDIWTRGAWDNIKEVLPAEMLN 2 DEEL+ +VYE+L+ +RYLVV+DDIW+ AWD +K+ P + N Sbjct: 250 DEELEDLVYENLRRKRYLVVLDDIWSTNAWDCLKKAFPVDRSN 292 >gb|ABV30822.1| NBS-containing resistance-like protein [Platanus x acerifolia] Length = 164 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -2 Query: 127 EELKKVVYEHLKERRYLVVIDDIWTRGAWDNIKEVLP 17 EEL++ V+E LKERRYLVV+DDIW+R AW+ +K LP Sbjct: 57 EELEEKVFELLKERRYLVVLDDIWSREAWETLKNALP 93 >gb|ABV30820.1| NBS-containing resistance-like protein [Platanus x acerifolia] Length = 164 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -2 Query: 127 EELKKVVYEHLKERRYLVVIDDIWTRGAWDNIKEVLP 17 EEL++ V+E LKERRYLVV+DDIW+R AW+ +K LP Sbjct: 57 EELEEKVFELLKERRYLVVLDDIWSREAWETLKNALP 93 >gb|ABV30819.1| NBS-containing resistance-like protein [Platanus x acerifolia] Length = 164 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -2 Query: 127 EELKKVVYEHLKERRYLVVIDDIWTRGAWDNIKEVLP 17 EEL++ V+E LKERRYLVV+DDIW+R AW+ +K LP Sbjct: 57 EELEEKVFELLKERRYLVVLDDIWSREAWETLKNALP 93