BLASTX nr result
ID: Dioscorea21_contig00025789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025789 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003572767.1| PREDICTED: uncharacterized protein LOC100832... 60 2e-07 ref|XP_002302492.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 gb|AFW63252.1| hypothetical protein ZEAMMB73_923386 [Zea mays] 58 7e-07 dbj|BAJ95799.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 7e-07 ref|XP_002511597.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_003572767.1| PREDICTED: uncharacterized protein LOC100832470 [Brachypodium distachyon] Length = 389 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 244 EKDILLQLLRTEANNSEGRLQVKEKLYFDAMPPSLQMHFEIIEKLD 107 EKD +LQLL+ EA N EGRL + EK YFD P SL MHFEI+E +D Sbjct: 342 EKDTMLQLLQDEAKNCEGRLLLSEKKYFDGRPLSLLMHFEILEVMD 387 >ref|XP_002302492.1| predicted protein [Populus trichocarpa] gi|222844218|gb|EEE81765.1| predicted protein [Populus trichocarpa] Length = 321 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 244 EKDILLQLLRTEANNSEGRLQVKEKLYFDAMPPSLQMHFEIIEKLD 107 EKD L+ LL +E+ S G+LQV EK YF PPSLQMHFEIIE +D Sbjct: 274 EKDKLVHLLESESRRSGGKLQVCEKFYFGDRPPSLQMHFEIIEDMD 319 >gb|AFW63252.1| hypothetical protein ZEAMMB73_923386 [Zea mays] Length = 337 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -3 Query: 247 KEKDILLQLLRTEANNSEGRLQVKEKLYFDAMPPSLQMHFEIIEKLD 107 +EKD ++Q+L EA SEGRL + EKLYF+ P SL MHFE++E +D Sbjct: 290 EEKDAMVQVLADEARRSEGRLVLSEKLYFEGRPRSLLMHFEVLEAMD 336 >dbj|BAJ95799.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 342 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -3 Query: 244 EKDILLQLLRTEANNSEGRLQVKEKLYFDAMPPSLQMHFEIIEKLD 107 EK+ +L+LLR EAN EGRL + EK YFD P S+ MHFEI+E +D Sbjct: 295 EKNTMLRLLRDEANKCEGRLTLSEKKYFDGRPRSVLMHFEILEAMD 340 >ref|XP_002511597.1| conserved hypothetical protein [Ricinus communis] gi|223548777|gb|EEF50266.1| conserved hypothetical protein [Ricinus communis] Length = 320 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -3 Query: 247 KEKDILLQLLRTEANNSEGRLQVKEKLYFDAMPPSLQMHFEIIEKLD 107 KEKD L+ LL++EA S G+L+V EK YF P+LQMHFEIIE +D Sbjct: 272 KEKDKLINLLQSEARKSGGKLKVCEKFYFADRAPNLQMHFEIIENMD 318