BLASTX nr result
ID: Dioscorea21_contig00025604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025604 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002871289.1| predicted protein [Arabidopsis lyrata subsp.... 55 6e-06 >ref|XP_002871289.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297317126|gb|EFH47548.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 607 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +3 Query: 3 SAIGFKLKSLQNLSDIRMRNSNMTLMHYLCKAFLVSVEAEII 128 SA+GFKL SL LSD R NSNMTLMHYLCK L S ++++ Sbjct: 430 SAVGFKLDSLLKLSDTRASNSNMTLMHYLCKQVLASKASDLL 471