BLASTX nr result
ID: Dioscorea21_contig00025574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025574 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143512.1| PREDICTED: methyltransferase-like protein 21... 58 9e-07 ref|XP_003629450.1| hypothetical protein MTR_8g077610 [Medicago ... 57 2e-06 ref|XP_002521594.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 ref|XP_003518024.1| PREDICTED: methyltransferase-like protein 21... 55 6e-06 >ref|XP_004143512.1| PREDICTED: methyltransferase-like protein 21C-like [Cucumis sativus] gi|449519816|ref|XP_004166930.1| PREDICTED: methyltransferase-like protein 21C-like [Cucumis sativus] Length = 267 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 3/44 (6%) Frame = -3 Query: 194 HYLNSISASLSIRQLRSQGLSFQLWPAAHSLVSLLD---SNPQT 72 H++ SI ++LSIRQL SQGLSFQLWPAA +LV+LLD S PQT Sbjct: 34 HFIPSIDSTLSIRQLPSQGLSFQLWPAATTLVNLLDDHRSRPQT 77 >ref|XP_003629450.1| hypothetical protein MTR_8g077610 [Medicago truncatula] gi|355523472|gb|AET03926.1| hypothetical protein MTR_8g077610 [Medicago truncatula] Length = 245 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = -3 Query: 200 QEHYLNSISASLSIRQLRSQGLSFQLWPAAHSLVSLLDS---NPQT 72 Q H+L+SI ++++IR L SQGLSFQLWPAA SLV+LLD+ NP T Sbjct: 27 QTHFLHSIQSTVTIRSLPSQGLSFQLWPAATSLVTLLDNHRLNPTT 72 >ref|XP_002521594.1| conserved hypothetical protein [Ricinus communis] gi|223539272|gb|EEF40865.1| conserved hypothetical protein [Ricinus communis] Length = 268 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/49 (55%), Positives = 37/49 (75%), Gaps = 3/49 (6%) Frame = -3 Query: 209 EHQQEHYLNSISASLSIRQLRSQGLSFQLWPAAHSLVSLLD---SNPQT 72 + Q HY+ SI++++ +RQL SQGLSFQLWPAA +L +LLD S+P T Sbjct: 42 QQDQRHYIPSINSTIMVRQLPSQGLSFQLWPAATTLFTLLDRHRSDPTT 90 >ref|XP_003518024.1| PREDICTED: methyltransferase-like protein 21A-like [Glycine max] Length = 259 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 200 QEHYLNSISASLSIRQLRSQGLSFQLWPAAHSLVSLLD 87 Q H L SI ++++IRQL S+GLSFQLWPAA SLVSLLD Sbjct: 43 QHHPLRSIQSTVAIRQLPSEGLSFQLWPAATSLVSLLD 80