BLASTX nr result
ID: Dioscorea21_contig00025539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025539 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512070.1| RNA binding protein, putative [Ricinus commu... 56 3e-06 >ref|XP_002512070.1| RNA binding protein, putative [Ricinus communis] gi|223549250|gb|EEF50739.1| RNA binding protein, putative [Ricinus communis] Length = 355 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/61 (49%), Positives = 40/61 (65%) Frame = +3 Query: 3 VNGCHRDLLKRFGSHGCANERPQGVRQNAAEEMDLNLGLSLGGCFGVEPREKKLVRSSSI 182 +N RDLL+RF S+ + ++ EE++LNLGLSLGG FGV+ KKL RSSSI Sbjct: 25 INKYPRDLLQRFMSNDSQQLKTSEGEEDNTEEIELNLGLSLGGRFGVDKTSKKLTRSSSI 84 Query: 183 S 185 + Sbjct: 85 A 85