BLASTX nr result
ID: Dioscorea21_contig00025536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025536 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABS84825.1| thioredoxin [Limonium bicolor] 74 2e-11 ref|XP_002282265.2| PREDICTED: thioredoxin M4, chloroplastic-lik... 69 4e-10 ref|XP_002316901.1| thioredoxin m [Populus trichocarpa] gi|22285... 64 1e-08 gb|AGG19198.1| mitochondrial thioredoxin M-type 9, partial [Tama... 63 2e-08 ref|XP_002520230.1| thioredoxin m(mitochondrial)-type, putative ... 62 4e-08 >gb|ABS84825.1| thioredoxin [Limonium bicolor] Length = 187 Score = 73.6 bits (179), Expect = 2e-11 Identities = 39/80 (48%), Positives = 52/80 (65%), Gaps = 3/80 (3%) Frame = -3 Query: 233 SRKPGFLSGFKGLAITNYSSRRSLMRAQNFRSSGC---GAIVCERPASTTEVPDVTKATW 63 +R+P L+ F GL + + +S R R + RSSG G +VCE P + EV VT ++W Sbjct: 36 ARQPVKLAKFSGLRVISSASTR---RLRPLRSSGVRRSGRVVCESPDTAVEVQSVTDSSW 92 Query: 62 QSLVLDSDTPVLVLFWATWC 3 QSLVL+SD+PVLV FWA WC Sbjct: 93 QSLVLESDSPVLVEFWAPWC 112 >ref|XP_002282265.2| PREDICTED: thioredoxin M4, chloroplastic-like [Vitis vinifera] gi|302143024|emb|CBI20319.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 68.9 bits (167), Expect = 4e-10 Identities = 42/90 (46%), Positives = 48/90 (53%), Gaps = 11/90 (12%) Frame = -3 Query: 239 LASRKPGFLSG---------FKGLAITNYSSRRSLMRAQNFRSSG--CGAIVCERPASTT 93 +AS FLSG F GL I + RS+ A G G +VCE + Sbjct: 24 IASSPVCFLSGRRGLARLPEFSGLKIQPSLASRSVAAAGRSSRVGRRVGGVVCEAQETAV 83 Query: 92 EVPDVTKATWQSLVLDSDTPVLVLFWATWC 3 EVP V ATWQSLVLD+DTPVLV FWA WC Sbjct: 84 EVPAVIDATWQSLVLDADTPVLVEFWAPWC 113 >ref|XP_002316901.1| thioredoxin m [Populus trichocarpa] gi|222859966|gb|EEE97513.1| thioredoxin m [Populus trichocarpa] Length = 190 Score = 64.3 bits (155), Expect = 1e-08 Identities = 41/88 (46%), Positives = 52/88 (59%), Gaps = 5/88 (5%) Frame = -3 Query: 251 FSSTLASRKPGFLSGFKGLAITNYSS---RRSL--MRAQNFRSSGCGAIVCERPASTTEV 87 F+ST+ R F KGL I +SS RSL + + R + G IVCE +V Sbjct: 29 FASTINRRSLRFPQ-LKGLKIHFHSSSTVNRSLGSVSQSSSRLACAGRIVCEAQDIAVKV 87 Query: 86 PDVTKATWQSLVLDSDTPVLVLFWATWC 3 P VT ATW+SLVL+S++PVLV FWA WC Sbjct: 88 PAVTDATWKSLVLESESPVLVEFWAPWC 115 >gb|AGG19198.1| mitochondrial thioredoxin M-type 9, partial [Tamarix hispida] Length = 160 Score = 63.2 bits (152), Expect = 2e-08 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 3/85 (3%) Frame = -3 Query: 248 SSTLASRKPGFLSGFKGLAITNYSSRRSLMRAQNFRSS---GCGAIVCERPASTTEVPDV 78 +S A+ + L F+GL + + S S +R+ N +S G G IVCE P + E V Sbjct: 2 TSVSANSQLAKLPEFRGLKVKSRFST-SFVRSTNLKSRIVRGAGRIVCESPDTAVESSSV 60 Query: 77 TKATWQSLVLDSDTPVLVLFWATWC 3 + TW S VL SD PVLV FWA WC Sbjct: 61 NETTWDSSVLGSDLPVLVEFWAPWC 85 >ref|XP_002520230.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] gi|223540576|gb|EEF42142.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] Length = 181 Score = 62.4 bits (150), Expect = 4e-08 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 2/83 (2%) Frame = -3 Query: 245 STLASRKPGF-LSGFKGLAITNYSSRRSLMRAQ-NFRSSGCGAIVCERPASTTEVPDVTK 72 S+ +R+P L KGL +++ ++ RSL R+ + + G IVCE + EV VT Sbjct: 24 SSSVNRRPAVTLPVAKGLKVSSVTTARSLARSPPRSQLARPGRIVCEAQDTAVEVLAVTD 83 Query: 71 ATWQSLVLDSDTPVLVLFWATWC 3 TW+SLVL+S+ PVLV FWA WC Sbjct: 84 QTWKSLVLESEFPVLVEFWAPWC 106