BLASTX nr result
ID: Dioscorea21_contig00025401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00025401 (195 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271824.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 emb|CAN70994.1| hypothetical protein VITISV_038698 [Vitis vinifera] 56 4e-06 >ref|XP_002271824.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880 [Vitis vinifera] gi|297734603|emb|CBI16654.3| unnamed protein product [Vitis vinifera] Length = 577 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +2 Query: 2 KEAGCSVIEVGSTALEFVSGDKMHPDWDVISNVIGDLHLQMK 127 KEAGCS IEV S EFV+GD++HP W+ I +V+G L + MK Sbjct: 518 KEAGCSAIEVDSRVWEFVAGDRVHPKWEAIHSVLGQLWVHMK 559 >emb|CAN70994.1| hypothetical protein VITISV_038698 [Vitis vinifera] Length = 751 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +2 Query: 2 KEAGCSVIEVGSTALEFVSGDKMHPDWDVISNVIGDLHLQMK 127 KEAGCS IEV S EFV+GD++HP W+ I +V+G L + MK Sbjct: 692 KEAGCSAIEVDSRVWEFVAGDRVHPKWEAIHSVLGQLWVHMK 733