BLASTX nr result
ID: Dioscorea21_contig00024963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00024963 (598 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80353.1| hypothetical protein VITISV_003141 [Vitis vinifera] 59 2e-09 ref|XP_003610233.1| RING finger protein [Medicago truncatula] gi... 67 2e-09 ref|XP_002531110.1| conserved hypothetical protein [Ricinus comm... 60 2e-09 ref|NP_001173031.1| Os02g0572350 [Oryza sativa Japonica Group] g... 65 9e-09 ref|XP_002884394.1| zinc finger family protein [Arabidopsis lyra... 65 9e-09 >emb|CAN80353.1| hypothetical protein VITISV_003141 [Vitis vinifera] Length = 209 Score = 59.3 bits (142), Expect(2) = 2e-09 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 142 LRLLPNCGHSFHATCIDTWFTCHSNCPLCRASV 44 L+ LPNC H FH CIDTWF HSNCPLCR+ V Sbjct: 73 LKHLPNCSHVFHIPCIDTWFESHSNCPLCRSHV 105 Score = 28.1 bits (61), Expect(2) = 2e-09 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 240 NHQANTATHEPSIQSESRGLAAAVIHSLPKLQF 142 N ++PS Q SRGL ++ ++SLP QF Sbjct: 15 NFWTKPTLNDPSQQFHSRGLDSSTVYSLPIAQF 47 >ref|XP_003610233.1| RING finger protein [Medicago truncatula] gi|355511288|gb|AES92430.1| RING finger protein [Medicago truncatula] Length = 511 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -1 Query: 142 LRLLPNCGHSFHATCIDTWFTCHSNCPLCRASVLHGFN 29 LRLLP C H+FH CIDTW HS CPLCRA++LH FN Sbjct: 157 LRLLPKCSHAFHMECIDTWLLSHSTCPLCRANLLHDFN 194 >ref|XP_002531110.1| conserved hypothetical protein [Ricinus communis] gi|223529306|gb|EEF31275.1| conserved hypothetical protein [Ricinus communis] Length = 199 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 142 LRLLPNCGHSFHATCIDTWFTCHSNCPLCRASV 44 L+ LPNC H FH CIDTWF HSNCPLCR+ V Sbjct: 105 LKHLPNCAHVFHVACIDTWFQTHSNCPLCRSHV 137 Score = 26.9 bits (58), Expect(2) = 2e-09 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 213 EPSIQSESRGLAAAVIHSLPKLQF 142 + S+Q S GL + ++HSLP QF Sbjct: 54 DSSLQIHSHGLESTIMHSLPITQF 77 >ref|NP_001173031.1| Os02g0572350 [Oryza sativa Japonica Group] gi|46806010|dbj|BAD17284.1| zinc finger (C3HC4-type RING finger)-like protein [Oryza sativa Japonica Group] gi|255671016|dbj|BAH91760.1| Os02g0572350 [Oryza sativa Japonica Group] Length = 325 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -1 Query: 145 ILRLLPNCGHSFHATCIDTWFTCHSNCPLCRASVLH 38 +LRLLP CGH+FH CID W H NCPLCRA VLH Sbjct: 121 LLRLLPKCGHAFHVPCIDAWLRAHVNCPLCRAHVLH 156 >ref|XP_002884394.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297330234|gb|EFH60653.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 355 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/52 (57%), Positives = 33/52 (63%) Frame = -1 Query: 172 CHSLTSKTTILRLLPNCGHSFHATCIDTWFTCHSNCPLCRASVLHGFNVCSS 17 C S + LRLLP C H+FH CIDTW HSNCPLCRA + G NV SS Sbjct: 155 CLSEFQENESLRLLPKCNHAFHVPCIDTWLKSHSNCPLCRAFIA-GVNVTSS 205