BLASTX nr result
ID: Dioscorea21_contig00024871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00024871 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306748.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002302135.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_004144632.1| PREDICTED: vacuolar protein sorting-associat... 72 6e-11 ref|XP_003599782.1| Vacuolar protein sorting-associated protein-... 72 6e-11 dbj|BAJ33734.1| unnamed protein product [Thellungiella halophila] 71 8e-11 >ref|XP_002306748.1| predicted protein [Populus trichocarpa] gi|222856197|gb|EEE93744.1| predicted protein [Populus trichocarpa] Length = 844 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 34 QVPLLLSIAEEDTALVKATESGDTDLVYLVLLHIWQK 144 QVPLLLSIAEEDTAL+KATESGDTDLVYLVL HIWQK Sbjct: 540 QVPLLLSIAEEDTALMKATESGDTDLVYLVLFHIWQK 576 >ref|XP_002302135.1| predicted protein [Populus trichocarpa] gi|222843861|gb|EEE81408.1| predicted protein [Populus trichocarpa] Length = 844 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 34 QVPLLLSIAEEDTALVKATESGDTDLVYLVLLHIWQK 144 QVPLLLSIAEE+TALVKATESGDTDLVYLVL HIWQK Sbjct: 540 QVPLLLSIAEEETALVKATESGDTDLVYLVLFHIWQK 576 >ref|XP_004144632.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog [Cucumis sativus] gi|449519144|ref|XP_004166595.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog [Cucumis sativus] Length = 844 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 34 QVPLLLSIAEEDTALVKATESGDTDLVYLVLLHIWQK 144 QVPLLLSI EEDTAL+KATESGDTDLVYLVL HIWQK Sbjct: 540 QVPLLLSIGEEDTALIKATESGDTDLVYLVLFHIWQK 576 >ref|XP_003599782.1| Vacuolar protein sorting-associated protein-like protein [Medicago truncatula] gi|355488830|gb|AES70033.1| Vacuolar protein sorting-associated protein-like protein [Medicago truncatula] Length = 856 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +1 Query: 34 QVPLLLSIAEEDTALVKATESGDTDLVYLVLLHIWQKIL 150 QVPLLLSI EEDTAL+KATE GDTDLVYLVL HIWQK+L Sbjct: 546 QVPLLLSIGEEDTALMKATECGDTDLVYLVLFHIWQKVL 584 >dbj|BAJ33734.1| unnamed protein product [Thellungiella halophila] Length = 833 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 34 QVPLLLSIAEEDTALVKATESGDTDLVYLVLLHIWQK 144 QVPLLLSI EEDTALVKATESGDTDLVYLV+ HIWQK Sbjct: 534 QVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQK 570