BLASTX nr result
ID: Dioscorea21_contig00024594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00024594 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM63715.1| unknown [Arabidopsis thaliana] 81 1e-13 emb|CAB87718.1| putative protein [Arabidopsis thaliana] 77 1e-12 ref|NP_568250.1| regulator of chromosome condensation repeat-con... 77 1e-12 ref|XP_002516507.1| Protein pim1, putative [Ricinus communis] gi... 77 1e-12 ref|XP_002871480.1| hypothetical protein ARALYDRAFT_487995 [Arab... 77 2e-12 >gb|AAM63715.1| unknown [Arabidopsis thaliana] Length = 553 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/55 (67%), Positives = 43/55 (78%) Frame = -3 Query: 226 KVVQIAAGEAHTLALAGDGSVLSWGRGTFGRLGTGKEHDEHSPVRVYFPDASSKE 62 K++ +AAGEAHT+AL GDG V SWGRG FGRLGTGKE DE PVRV FP+ + E Sbjct: 17 KIISLAAGEAHTIALTGDGCVYSWGRGMFGRLGTGKESDELVPVRVEFPNQAEGE 71 >emb|CAB87718.1| putative protein [Arabidopsis thaliana] Length = 541 Score = 77.4 bits (189), Expect = 1e-12 Identities = 37/65 (56%), Positives = 45/65 (69%) Frame = -3 Query: 226 KVVQIAAGEAHTLALAGDGSVLSWGRGTFGRLGTGKEHDEHSPVRVYFPDASSKELTSDP 47 K++ +AAGEAHT+AL GDG V SWGRG FGRLGTGKE DE PV V FP+ + + Sbjct: 17 KIISLAAGEAHTIALTGDGCVYSWGRGMFGRLGTGKESDELVPVLVEFPNQAEGDRIRIV 76 Query: 46 SVPSG 32 V +G Sbjct: 77 GVAAG 81 >ref|NP_568250.1| regulator of chromosome condensation repeat-containing protein [Arabidopsis thaliana] gi|16604485|gb|AAL24248.1| AT5g11580/F15N18_170 [Arabidopsis thaliana] gi|18958034|gb|AAL79590.1| AT5g11580/F15N18_170 [Arabidopsis thaliana] gi|332004314|gb|AED91697.1| regulator of chromosome condensation repeat-containing protein [Arabidopsis thaliana] Length = 553 Score = 77.4 bits (189), Expect = 1e-12 Identities = 37/65 (56%), Positives = 45/65 (69%) Frame = -3 Query: 226 KVVQIAAGEAHTLALAGDGSVLSWGRGTFGRLGTGKEHDEHSPVRVYFPDASSKELTSDP 47 K++ +AAGEAHT+AL GDG V SWGRG FGRLGTGKE DE PV V FP+ + + Sbjct: 17 KIISLAAGEAHTIALTGDGCVYSWGRGMFGRLGTGKESDELVPVLVEFPNQAEGDRIRIV 76 Query: 46 SVPSG 32 V +G Sbjct: 77 GVAAG 81 >ref|XP_002516507.1| Protein pim1, putative [Ricinus communis] gi|223544327|gb|EEF45848.1| Protein pim1, putative [Ricinus communis] Length = 565 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -3 Query: 226 KVVQIAAGEAHTLALAGDGSVLSWGRGTFGRLGTGKEHDEHSPVRVYF 83 KVV +AAGEAHTLAL GDG V SWGRGTFGRLGTG E DE PV+V F Sbjct: 17 KVVSVAAGEAHTLALTGDGCVYSWGRGTFGRLGTGLEKDELYPVKVKF 64 >ref|XP_002871480.1| hypothetical protein ARALYDRAFT_487995 [Arabidopsis lyrata subsp. lyrata] gi|297317317|gb|EFH47739.1| hypothetical protein ARALYDRAFT_487995 [Arabidopsis lyrata subsp. lyrata] Length = 554 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 226 KVVQIAAGEAHTLALAGDGSVLSWGRGTFGRLGTGKEHDEHSPVRVYF 83 K++ +AAGEAHT+AL GDG V SWGRG FGRLGTGKE DE PVRV F Sbjct: 17 KIISLAAGEAHTIALTGDGCVYSWGRGMFGRLGTGKESDELVPVRVEF 64