BLASTX nr result
ID: Dioscorea21_contig00024553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00024553 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633471.1| PREDICTED: uncharacterized protein LOC100854... 60 2e-07 ref|XP_003600803.1| hypothetical protein MTR_3g069540 [Medicago ... 57 2e-06 ref|XP_002524254.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_003516905.1| PREDICTED: uncharacterized protein LOC100806... 55 8e-06 >ref|XP_003633471.1| PREDICTED: uncharacterized protein LOC100854960 [Vitis vinifera] gi|296086146|emb|CBI31587.3| unnamed protein product [Vitis vinifera] Length = 76 Score = 60.1 bits (144), Expect = 2e-07 Identities = 20/33 (60%), Positives = 27/33 (81%) Frame = -1 Query: 271 LGIMCECCDGDGGACRSTWDSTCAKLNCHNWKF 173 LG++C+CCDG+GG CRSTW+ +C KL C WK+ Sbjct: 43 LGVVCKCCDGEGGECRSTWEGSCPKLQCLPWKY 75 >ref|XP_003600803.1| hypothetical protein MTR_3g069540 [Medicago truncatula] gi|355489851|gb|AES71054.1| hypothetical protein MTR_3g069540 [Medicago truncatula] Length = 94 Score = 57.0 bits (136), Expect = 2e-06 Identities = 19/33 (57%), Positives = 27/33 (81%) Frame = -1 Query: 271 LGIMCECCDGDGGACRSTWDSTCAKLNCHNWKF 173 LG++C+CCDG+GG C STWD++C+ L C WK+ Sbjct: 62 LGLVCKCCDGEGGDCISTWDASCSNLMCKPWKY 94 >ref|XP_002524254.1| conserved hypothetical protein [Ricinus communis] gi|223536531|gb|EEF38178.1| conserved hypothetical protein [Ricinus communis] Length = 79 Score = 57.0 bits (136), Expect = 2e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -1 Query: 271 LGIMCECCDGDGGACRSTWDSTCAKLNCHNWK 176 LG+ C+CCDG G CRS+W+S+C KL CH WK Sbjct: 46 LGLECKCCDGAHGECRSSWESSCPKLQCHPWK 77 >ref|XP_003516905.1| PREDICTED: uncharacterized protein LOC100806570 [Glycine max] Length = 83 Score = 54.7 bits (130), Expect = 8e-06 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -1 Query: 271 LGIMCECCDGDGGACRSTWDSTCAKLNCHNWK 176 LG++C+CCDG GGAC STW +C+ L C WK Sbjct: 49 LGLVCKCCDGVGGACTSTWTESCSNLQCSPWK 80