BLASTX nr result
ID: Dioscorea21_contig00024501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00024501 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_197280.2| hydrolase, alpha/beta fold family protein [Arab... 58 7e-07 ref|NP_001119241.1| hydrolase, alpha/beta fold family protein [A... 58 7e-07 >ref|NP_197280.2| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana] gi|45935035|gb|AAS79552.1| alpha/beta fold family protein hydrolase [Arabidopsis thaliana] gi|46367474|emb|CAG25863.1| hypothetical protein [Arabidopsis thaliana] gi|332005084|gb|AED92467.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana] Length = 417 Score = 58.2 bits (139), Expect = 7e-07 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 15/112 (13%) Frame = -1 Query: 298 ALISSLNFIVFTIMXXXXXXXXXXXXXXXXXLEENPVPCYCYV-----KCEDEDELS-DS 137 A+ ++L+FIVF + LEEN CYC + DE+ELS ++ Sbjct: 10 AIHAALSFIVFFFLDLLDAILCVVYEFVDEILEENSTGCYCTAAAPQSQTTDENELSSET 69 Query: 136 LCGRSNLFRKM---------VACCKRRRKRNGVLRPSSRRWSDCGCSECASW 8 L GR N+FR M + R+ +++ + + S RWSDCGC C SW Sbjct: 70 LFGRRNIFRGMWFLGFAREFKSKLSRKLRKSKIHQESVNRWSDCGCKSCKSW 121 >ref|NP_001119241.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana] gi|332005085|gb|AED92468.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana] Length = 419 Score = 58.2 bits (139), Expect = 7e-07 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 15/112 (13%) Frame = -1 Query: 298 ALISSLNFIVFTIMXXXXXXXXXXXXXXXXXLEENPVPCYCYV-----KCEDEDELS-DS 137 A+ ++L+FIVF + LEEN CYC + DE+ELS ++ Sbjct: 10 AIHAALSFIVFFFLDLLDAILCVVYEFVDEILEENSTGCYCTAAAPQSQTTDENELSSET 69 Query: 136 LCGRSNLFRKM---------VACCKRRRKRNGVLRPSSRRWSDCGCSECASW 8 L GR N+FR M + R+ +++ + + S RWSDCGC C SW Sbjct: 70 LFGRRNIFRGMWFLGFAREFKSKLSRKLRKSKIHQESVNRWSDCGCKSCKSW 121