BLASTX nr result
ID: Dioscorea21_contig00023899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023899 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556622.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 56 3e-06 >ref|XP_003556622.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D11-like [Glycine max] Length = 504 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 232 FDWRLPNGMVTEELDMSESPGLTVRMKKNLYLIPKL 125 FDW+LPN M TE+LDM+E GLTV+ KK+LYLIP L Sbjct: 467 FDWKLPNRMKTEDLDMTEQFGLTVKRKKDLYLIPSL 502