BLASTX nr result
ID: Dioscorea21_contig00023486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023486 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAE04958.2| OSJNBa0070D17.9 [Oryza sativa Japonica Group] 57 2e-06 ref|XP_002515373.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >emb|CAE04958.2| OSJNBa0070D17.9 [Oryza sativa Japonica Group] Length = 394 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/57 (43%), Positives = 34/57 (59%) Frame = -3 Query: 279 GSAGRLKEQPVSVLQQRTIVRKGKLVHQALVQWEGLDENDSSWEDVDKLEEYFPEIN 109 G G++K QP +VLQ+R + R G V Q L+ WE L D++WED D + FP N Sbjct: 337 GPEGQIKTQPTAVLQRRMMPRNGVAVTQWLILWENLGPTDATWEDADVIRNMFPTFN 393 >ref|XP_002515373.1| conserved hypothetical protein [Ricinus communis] gi|223545317|gb|EEF46822.1| conserved hypothetical protein [Ricinus communis] Length = 121 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/58 (41%), Positives = 37/58 (63%) Frame = -3 Query: 273 AGRLKEQPVSVLQQRTIVRKGKLVHQALVQWEGLDENDSSWEDVDKLEEYFPEINLED 100 +G LK + +++L R +VRK ++ Q LVQW L D+ WED+ L+ FP++ LED Sbjct: 18 SGELKMESIAILNTRELVRKKSMIPQVLVQWANLRPEDAKWEDMQFLKAQFPDLVLED 75