BLASTX nr result
ID: Dioscorea21_contig00023335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023335 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521863.1| PREDICTED: uncharacterized protein LOC100814... 61 8e-08 >ref|XP_003521863.1| PREDICTED: uncharacterized protein LOC100814308 [Glycine max] Length = 523 Score = 61.2 bits (147), Expect = 8e-08 Identities = 35/53 (66%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = -3 Query: 188 QMLTSVLSSLVAEEAA-LNGARNTANFSNSPPLFPMEKRLKLENPISVPDASN 33 QMLTSVLSSLVAEEAA LNG+ N+ FS+ P+F EKR KLE P DASN Sbjct: 334 QMLTSVLSSLVAEEAASLNGSLNSTGFSSGLPIFNPEKRPKLEKPTPAHDASN 386