BLASTX nr result
ID: Dioscorea21_contig00023267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023267 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW82204.1| hypothetical protein ZEAMMB73_115678 [Zea mays] 81 1e-13 gb|ACN33384.1| unknown [Zea mays] gi|413949552|gb|AFW82201.1| hy... 81 1e-13 ref|NP_001146213.1| uncharacterized protein LOC100279783 [Zea ma... 81 1e-13 gb|ACF84350.1| unknown [Zea mays] gi|413949550|gb|AFW82199.1| hy... 81 1e-13 gb|ACF80004.1| unknown [Zea mays] gi|413949551|gb|AFW82200.1| hy... 81 1e-13 >gb|AFW82204.1| hypothetical protein ZEAMMB73_115678 [Zea mays] Length = 196 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/53 (75%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 ILLIQQNRKAEGERMSKWAEATWRNRRLSLAQALEFSEPSQ-AAVIDTRISRV 158 +LLIQ NRKAEGERM +WAE WRNRRL+LAQALEFSEPS+ V+DTRI RV Sbjct: 143 LLLIQSNRKAEGERMKQWAEDAWRNRRLTLAQALEFSEPSKPTVVVDTRIGRV 195 >gb|ACN33384.1| unknown [Zea mays] gi|413949552|gb|AFW82201.1| hypothetical protein ZEAMMB73_115678 [Zea mays] Length = 356 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/53 (75%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 ILLIQQNRKAEGERMSKWAEATWRNRRLSLAQALEFSEPSQ-AAVIDTRISRV 158 +LLIQ NRKAEGERM +WAE WRNRRL+LAQALEFSEPS+ V+DTRI RV Sbjct: 303 LLLIQSNRKAEGERMKQWAEDAWRNRRLTLAQALEFSEPSKPTVVVDTRIGRV 355 >ref|NP_001146213.1| uncharacterized protein LOC100279783 [Zea mays] gi|219886205|gb|ACL53477.1| unknown [Zea mays] Length = 417 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/53 (75%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 ILLIQQNRKAEGERMSKWAEATWRNRRLSLAQALEFSEPSQ-AAVIDTRISRV 158 +LLIQ NRKAEGERM +WAE WRNRRL+LAQALEFSEPS+ V+DTRI RV Sbjct: 364 LLLIQSNRKAEGERMKQWAEDAWRNRRLTLAQALEFSEPSKPTVVVDTRIGRV 416 >gb|ACF84350.1| unknown [Zea mays] gi|413949550|gb|AFW82199.1| hypothetical protein ZEAMMB73_115678 [Zea mays] Length = 417 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/53 (75%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 ILLIQQNRKAEGERMSKWAEATWRNRRLSLAQALEFSEPSQ-AAVIDTRISRV 158 +LLIQ NRKAEGERM +WAE WRNRRL+LAQALEFSEPS+ V+DTRI RV Sbjct: 364 LLLIQSNRKAEGERMKQWAEDAWRNRRLTLAQALEFSEPSKPTVVVDTRIGRV 416 >gb|ACF80004.1| unknown [Zea mays] gi|413949551|gb|AFW82200.1| hypothetical protein ZEAMMB73_115678 [Zea mays] Length = 401 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/53 (75%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 ILLIQQNRKAEGERMSKWAEATWRNRRLSLAQALEFSEPSQ-AAVIDTRISRV 158 +LLIQ NRKAEGERM +WAE WRNRRL+LAQALEFSEPS+ V+DTRI RV Sbjct: 348 LLLIQSNRKAEGERMKQWAEDAWRNRRLTLAQALEFSEPSKPTVVVDTRIGRV 400