BLASTX nr result
ID: Dioscorea21_contig00023123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023123 (502 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533352.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002533352.1| conserved hypothetical protein [Ricinus communis] gi|223526817|gb|EEF29037.1| conserved hypothetical protein [Ricinus communis] Length = 112 Score = 59.7 bits (143), Expect = 2e-07 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 4/116 (3%) Frame = +3 Query: 84 MEGLIPFVIKVIKRKNTQRSYECLSTDHAKMFNVSNSTDTNGSMVFTEP----IEKLGGG 251 MEGL+P V K IKR T+R YECLS+ A +N ++ ++ +T+P +EK G Sbjct: 1 MEGLLPLVYKAIKRNRTRRQYECLSSGAAFAYNPADFYISDAETTYTKPSSIIMEKNNAG 60 Query: 252 LKEEKIHRRRMSMPEISDDLCSIELGEYKLRRQQRRPEKDFGFRSYRERVFACMGG 419 K+HRR S E DL G + R P + R +R+F+C+ G Sbjct: 61 TGRSKLHRRSYSSVE---DLS--VTGSSRRRTAGASPPRKQLVRFRSQRMFSCVTG 111