BLASTX nr result
ID: Dioscorea21_contig00023120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00023120 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514847.1| serine/threonine-protein kinase bri1, putati... 56 4e-06 >ref|XP_002514847.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223545898|gb|EEF47401.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Length = 1018 Score = 55.8 bits (133), Expect = 4e-06 Identities = 30/58 (51%), Positives = 34/58 (58%) Frame = -1 Query: 288 CELEKLPLSIPHLNFSSLSVLDLSYNYINFSGISWLFNIKSLQSLYLRDNYLHDRTIT 115 CEL PLS+PHLN +SL LDLS N N + SWLFN+ SL L L N L T Sbjct: 252 CELTNFPLSLPHLNLTSLLALDLSNNGFNSTLPSWLFNLSSLVYLDLSSNNLQGEVDT 309