BLASTX nr result
ID: Dioscorea21_contig00020421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00020421 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34018.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002268387.1| PREDICTED: HBS1-like protein-like [Vitis vin... 57 2e-06 >emb|CBI34018.3| unnamed protein product [Vitis vinifera] Length = 760 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/46 (45%), Positives = 33/46 (71%) Frame = +2 Query: 263 IKVEKKTTKLALWQCSVCNSDNEQSSSSCDICGVLRDPAQNIGNGS 400 ++ ++T + +W+CS+C DN++S S+CDICGVLR P NI N + Sbjct: 37 VETNQETVRRGIWRCSICTFDNDESMSACDICGVLRYPLVNIRNNN 82 >ref|XP_002268387.1| PREDICTED: HBS1-like protein-like [Vitis vinifera] Length = 686 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/46 (45%), Positives = 33/46 (71%) Frame = +2 Query: 263 IKVEKKTTKLALWQCSVCNSDNEQSSSSCDICGVLRDPAQNIGNGS 400 ++ ++T + +W+CS+C DN++S S+CDICGVLR P NI N + Sbjct: 37 VETNQETVRRGIWRCSICTFDNDESMSACDICGVLRYPLVNIRNNN 82