BLASTX nr result
ID: Dioscorea21_contig00020290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00020290 (199 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532673.1| Xyloglucan endotransglucosylase/hydrolase pr... 58 7e-07 gb|ABL10090.1| xyloglucan endotransglycosylase [Musa acuminata] 58 7e-07 gb|AAM28287.1| xyloglucan endotransglycosylase, partial [Ananas ... 57 2e-06 ref|XP_003610008.1| Xyloglucan endotransglucosylase/hydrolase [M... 56 3e-06 gb|ACK36945.1| xyloglucan endotransglycosylase [Annona cherimola] 56 3e-06 >ref|XP_002532673.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, putative [Ricinus communis] gi|223527586|gb|EEF29701.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, putative [Ricinus communis] Length = 258 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -2 Query: 198 AAMKSVQEKYMIYNYCTDVKRFSQGLPPECSL 103 A +K VQ+ YMIYNYCTD KRF QGLPPECSL Sbjct: 226 ARIKWVQQNYMIYNYCTDTKRFPQGLPPECSL 257 >gb|ABL10090.1| xyloglucan endotransglycosylase [Musa acuminata] Length = 280 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 192 MKSVQEKYMIYNYCTDVKRFSQGLPPECSL 103 MK VQ+ YMIYNYC+D+KRFSQGLPPECS+ Sbjct: 250 MKWVQKNYMIYNYCSDLKRFSQGLPPECSI 279 >gb|AAM28287.1| xyloglucan endotransglycosylase, partial [Ananas comosus] Length = 203 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 192 MKSVQEKYMIYNYCTDVKRFSQGLPPECS 106 +K VQ+ YM+YNYCTDVKRF QGLPPECS Sbjct: 173 LKWVQKNYMVYNYCTDVKRFPQGLPPECS 201 >ref|XP_003610008.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula] gi|355511063|gb|AES92205.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula] Length = 284 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 198 AAMKSVQEKYMIYNYCTDVKRFSQGLPPECSL 103 A ++ VQ+ YMIYNYCTD KRF QGLPPECSL Sbjct: 252 ARIQWVQKNYMIYNYCTDTKRFPQGLPPECSL 283 >gb|ACK36945.1| xyloglucan endotransglycosylase [Annona cherimola] Length = 292 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 192 MKSVQEKYMIYNYCTDVKRFSQGLPPECS 106 ++ VQEKYMIYNYCTD KRF QG PPECS Sbjct: 259 IRQVQEKYMIYNYCTDSKRFPQGFPPECS 287