BLASTX nr result
ID: Dioscorea21_contig00019948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019948 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517157.1| chloroplast-targeted copper chaperone, putat... 65 6e-09 ref|NP_850851.1| heavy metal transport/detoxification domain-con... 64 1e-08 ref|NP_197410.1| heavy metal transport/detoxification domain-con... 64 1e-08 ref|NP_001189822.1| heavy-metal-associated domain-containing pro... 64 1e-08 ref|XP_002884560.1| hypothetical protein ARALYDRAFT_477915 [Arab... 64 1e-08 >ref|XP_002517157.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223543792|gb|EEF45320.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Length = 526 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 156 SKEEFLKIQTCVLKVNIHCDGCKQKVKKLL 245 SKEEFLKIQTCVLKVNIHCDGCKQKVKK+L Sbjct: 2 SKEEFLKIQTCVLKVNIHCDGCKQKVKKIL 31 >ref|NP_850851.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|238481311|ref|NP_001154719.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005268|gb|AED92651.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005269|gb|AED92652.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Length = 465 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 156 SKEEFLKIQTCVLKVNIHCDGCKQKVKKLL 245 SKEEF+KIQTCVLKVNIHCDGCKQKVKK+L Sbjct: 2 SKEEFMKIQTCVLKVNIHCDGCKQKVKKIL 31 >ref|NP_197410.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005267|gb|AED92650.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Length = 587 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 156 SKEEFLKIQTCVLKVNIHCDGCKQKVKKLL 245 SKEEF+KIQTCVLKVNIHCDGCKQKVKK+L Sbjct: 2 SKEEFMKIQTCVLKVNIHCDGCKQKVKKIL 31 >ref|NP_001189822.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|332640828|gb|AEE74349.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Length = 349 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 156 SKEEFLKIQTCVLKVNIHCDGCKQKVKKLL 245 SKEEF+KIQTCVLKVNIHCDGCKQKVKK+L Sbjct: 2 SKEEFMKIQTCVLKVNIHCDGCKQKVKKIL 31 >ref|XP_002884560.1| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] gi|297330400|gb|EFH60819.1| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] Length = 445 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 156 SKEEFLKIQTCVLKVNIHCDGCKQKVKKLL 245 SKEEF+KIQTCVLKVNIHCDGCKQKVKK+L Sbjct: 2 SKEEFMKIQTCVLKVNIHCDGCKQKVKKIL 31