BLASTX nr result
ID: Dioscorea21_contig00019934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019934 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003577009.1| PREDICTED: putative pentatricopeptide repeat... 58 7e-07 ref|XP_002456972.1| hypothetical protein SORBIDRAFT_03g046570 [S... 55 5e-06 >ref|XP_003577009.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13800-like [Brachypodium distachyon] Length = 821 Score = 58.2 bits (139), Expect = 7e-07 Identities = 40/115 (34%), Positives = 53/115 (46%), Gaps = 2/115 (1%) Frame = +3 Query: 159 EAKASPLQSPQFGEFLLNLK--PGVALPVFNDSLALGLRRDLASYVAIVCILFASDDRHK 332 E ++ PL + L LK P +A F D+ ++G R D ++Y IV IL S Sbjct: 59 ERRSCPLSPANVVKTLQCLKRRPAIAFAYFKDAESVGFRHDFSTYAEIVHILSHSGQGRM 118 Query: 333 LVSLFADLVSSKPGVDFSFTDLFDTLSRFLNRSGKLLFVLDALIRAFTVCNKPRE 497 L SLF ++VS G L D L R S LLF + LI A T C R+ Sbjct: 119 LFSLFCEIVSPTSGGGPEIVPLMDQLKRTCTTSYPLLFATNCLITACTTCCDARD 173 >ref|XP_002456972.1| hypothetical protein SORBIDRAFT_03g046570 [Sorghum bicolor] gi|241928947|gb|EES02092.1| hypothetical protein SORBIDRAFT_03g046570 [Sorghum bicolor] Length = 821 Score = 55.5 bits (132), Expect = 5e-06 Identities = 34/105 (32%), Positives = 50/105 (47%) Frame = +3 Query: 207 LNLKPGVALPVFNDSLALGLRRDLASYVAIVCILFASDDRHKLVSLFADLVSSKPGVDFS 386 L KP VA F D+ +LG D ++Y I+ IL S LVSLF +++S Sbjct: 75 LRRKPAVAFAYFKDTHSLGFHHDFSTYSEIIQILSHSFQGKMLVSLFCEILSGTDSGGPE 134 Query: 387 FTDLFDTLSRFLNRSGKLLFVLDALIRAFTVCNKPREAFDAVVQL 521 L D L + S L + ++ LI+A+T C+ +E D L Sbjct: 135 ILALIDHLRKTCATSHVLSYAVNCLIKAYTTCHDAQETVDMFCHL 179