BLASTX nr result
ID: Dioscorea21_contig00019812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019812 (970 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD06417.1| cytochrome P450 [Asparagus officinalis] 49 1e-07 >dbj|BAD06417.1| cytochrome P450 [Asparagus officinalis] Length = 498 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +3 Query: 360 EILDFQVC*KICREMQFAVATIELALTNLVHHLCWEMPGGLRAEDLNTCLSP-MIYKYEH 536 E + F +IC M FA A +ELAL NL++ WE+P G+++EDL+ SP + + Sbjct: 425 EFVPFGAGRRICPGMHFAAANLELALANLMYRFDWELPDGMKSEDLDMGDSPGLTTRRRQ 484 Query: 537 YLHL 548 LHL Sbjct: 485 NLHL 488 Score = 33.1 bits (74), Expect(2) = 1e-07 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 11/44 (25%) Frame = +1 Query: 238 LASVMKEVIRKHPPTSLLLAQEN-----------PSKTIVIIKA 336 L +V+KE++R HPP LL+ +E+ PSKT V+I A Sbjct: 348 LKAVIKEILRLHPPVPLLIPRESMDHCNVQQYEVPSKTRVLINA 391