BLASTX nr result
ID: Dioscorea21_contig00019803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00019803 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543279.1| PREDICTED: indole-3-acetic acid-amido synthe... 78 6e-13 emb|CBI20465.3| unnamed protein product [Vitis vinifera] 75 4e-12 ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthe... 75 4e-12 ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthe... 75 4e-12 ref|XP_002319398.1| GH3 family protein [Populus trichocarpa] gi|... 75 7e-12 >ref|XP_003543279.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine max] Length = 611 Score = 78.2 bits (191), Expect = 6e-13 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -3 Query: 361 KAPRCVKSEPVVQLLDAKVLSNYFSPKCPKWVPGHKQWLKDN 236 KAPRCVK P+V+LL+++V SNYFSPKCPKWVPGHKQW+ N Sbjct: 570 KAPRCVKFAPIVELLNSRVTSNYFSPKCPKWVPGHKQWIHQN 611 >emb|CBI20465.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 75.5 bits (184), Expect = 4e-12 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 361 KAPRCVKSEPVVQLLDAKVLSNYFSPKCPKWVPGHKQWLKDN 236 K PRCVK P+++LL+++V+SNYFSPKCPKW+PGHKQW N Sbjct: 528 KTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCNKN 569 >ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 2 [Vitis vinifera] Length = 596 Score = 75.5 bits (184), Expect = 4e-12 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 361 KAPRCVKSEPVVQLLDAKVLSNYFSPKCPKWVPGHKQWLKDN 236 K PRCVK P+++LL+++V+SNYFSPKCPKW+PGHKQW N Sbjct: 555 KTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCNKN 596 >ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 1 [Vitis vinifera] gi|147866579|emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] Length = 613 Score = 75.5 bits (184), Expect = 4e-12 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 361 KAPRCVKSEPVVQLLDAKVLSNYFSPKCPKWVPGHKQWLKDN 236 K PRCVK P+++LL+++V+SNYFSPKCPKW+PGHKQW N Sbjct: 572 KTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCNKN 613 >ref|XP_002319398.1| GH3 family protein [Populus trichocarpa] gi|222857774|gb|EEE95321.1| GH3 family protein [Populus trichocarpa] Length = 608 Score = 74.7 bits (182), Expect = 7e-12 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 361 KAPRCVKSEPVVQLLDAKVLSNYFSPKCPKWVPGHKQWLKDN 236 KAPRCVK P+++LL+++V+SNY SPKCPKWVPGHKQW N Sbjct: 567 KAPRCVKYAPIIELLNSRVVSNYISPKCPKWVPGHKQWCTPN 608