BLASTX nr result
ID: Dioscorea21_contig00018892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00018892 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003573137.1| PREDICTED: uncharacterized protein LOC100834... 58 7e-07 >ref|XP_003573137.1| PREDICTED: uncharacterized protein LOC100834932 [Brachypodium distachyon] Length = 1115 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 5/49 (10%) Frame = -1 Query: 209 PGNDVS-EQLF----IDSGLHDHLHHLKIPHPSHGQRYGDIDGSWSPAY 78 P + VS EQLF DSG+ D L HL +P PSH QRYGD+D WSPAY Sbjct: 168 PSSPVSVEQLFGIGGNDSGIPDSLRHLNVPRPSHSQRYGDMDSPWSPAY 216