BLASTX nr result
ID: Dioscorea21_contig00018890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00018890 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514664.1| activating signal cointegrator 1 complex sub... 70 2e-10 ref|NP_200922.2| U5 small nuclear ribonucleoprotein helicase [Ar... 69 4e-10 ref|NP_001190584.1| U5 small nuclear ribonucleoprotein helicase ... 69 4e-10 ref|XP_003598950.1| Activating signal cointegrator 1 complex sub... 69 4e-10 ref|XP_002864717.1| hypothetical protein ARALYDRAFT_919354 [Arab... 69 4e-10 >ref|XP_002514664.1| activating signal cointegrator 1 complex subunit 3, helc1, putative [Ricinus communis] gi|223546268|gb|EEF47770.1| activating signal cointegrator 1 complex subunit 3, helc1, putative [Ricinus communis] Length = 2100 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -2 Query: 156 KVVADPSFSFRQQSLVVDTALALDKAKMMRFDEKSGNFYCTE 31 +V+ADPS S +Q+ L+ D A ALDKAKMMRFDEKSGNFYCTE Sbjct: 906 EVIADPSLSLKQRGLITDAARALDKAKMMRFDEKSGNFYCTE 947 >ref|NP_200922.2| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] gi|332010042|gb|AED97425.1| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] Length = 2146 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -2 Query: 156 KVVADPSFSFRQQSLVVDTALALDKAKMMRFDEKSGNFYCTE 31 +++ADPS S +Q++LV D A +LDKAKMMRFDEKSGNFYCTE Sbjct: 969 EIIADPSLSLKQRALVADAARSLDKAKMMRFDEKSGNFYCTE 1010 >ref|NP_001190584.1| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] gi|9759460|dbj|BAB10376.1| RNA helicase [Arabidopsis thaliana] gi|332010043|gb|AED97426.1| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] Length = 2157 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -2 Query: 156 KVVADPSFSFRQQSLVVDTALALDKAKMMRFDEKSGNFYCTE 31 +++ADPS S +Q++LV D A +LDKAKMMRFDEKSGNFYCTE Sbjct: 969 EIIADPSLSLKQRALVADAARSLDKAKMMRFDEKSGNFYCTE 1010 >ref|XP_003598950.1| Activating signal cointegrator 1 complex subunit [Medicago truncatula] gi|355487998|gb|AES69201.1| Activating signal cointegrator 1 complex subunit [Medicago truncatula] Length = 1465 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -2 Query: 156 KVVADPSFSFRQQSLVVDTALALDKAKMMRFDEKSGNFYCTE 31 +V+ADP+ S +Q+SLV+D A +LDKAKMMRFDEKSGNFYCTE Sbjct: 925 EVMADPALSSKQRSLVIDAARSLDKAKMMRFDEKSGNFYCTE 966 >ref|XP_002864717.1| hypothetical protein ARALYDRAFT_919354 [Arabidopsis lyrata subsp. lyrata] gi|297310552|gb|EFH40976.1| hypothetical protein ARALYDRAFT_919354 [Arabidopsis lyrata subsp. lyrata] Length = 2112 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -2 Query: 156 KVVADPSFSFRQQSLVVDTALALDKAKMMRFDEKSGNFYCTE 31 +++ADPS S +Q++LV D A +LDKAKMMRFDEKSGNFYCTE Sbjct: 935 EIIADPSLSLKQRALVADAARSLDKAKMMRFDEKSGNFYCTE 976