BLASTX nr result
ID: Dioscorea21_contig00018752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00018752 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003564967.1| PREDICTED: uncharacterized protein LOC100828... 94 1e-17 ref|XP_002456873.1| hypothetical protein SORBIDRAFT_03g044330 [S... 93 2e-17 tpg|DAA56060.1| TPA: hypothetical protein ZEAMMB73_833362 [Zea m... 92 4e-17 ref|NP_001147923.1| dek protein [Zea mays] gi|195614608|gb|ACG29... 90 2e-16 gb|EEC72065.1| hypothetical protein OsI_04995 [Oryza sativa Indi... 89 5e-16 >ref|XP_003564967.1| PREDICTED: uncharacterized protein LOC100828576 [Brachypodium distachyon] Length = 494 Score = 94.0 bits (232), Expect = 1e-17 Identities = 40/56 (71%), Positives = 52/56 (92%) Frame = +1 Query: 46 LEQMSFKLSKRKVDENLQALHTILFGRKANAHYLKRNISQFSGFVWTSDEEKQKTK 213 + +SFKLSKRK+DENLQ+LHTI+FGRK+N HYLKRNI+QFSGFVWT +E+KQ+++ Sbjct: 103 IPNVSFKLSKRKIDENLQSLHTIMFGRKSNVHYLKRNIAQFSGFVWTDNEDKQRSR 158 >ref|XP_002456873.1| hypothetical protein SORBIDRAFT_03g044330 [Sorghum bicolor] gi|241928848|gb|EES01993.1| hypothetical protein SORBIDRAFT_03g044330 [Sorghum bicolor] Length = 507 Score = 93.2 bits (230), Expect = 2e-17 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = +1 Query: 46 LEQMSFKLSKRKVDENLQALHTILFGRKANAHYLKRNISQFSGFVWTSDEEKQKTK 213 + +SFKLSKRKVDENLQ+LHT+L+GRK+N H+LKRNISQFSGFVWT ++EKQ+ K Sbjct: 117 IPNVSFKLSKRKVDENLQSLHTVLYGRKSNNHFLKRNISQFSGFVWTDNQEKQRNK 172 >tpg|DAA56060.1| TPA: hypothetical protein ZEAMMB73_833362 [Zea mays] Length = 502 Score = 92.0 bits (227), Expect = 4e-17 Identities = 40/56 (71%), Positives = 51/56 (91%) Frame = +1 Query: 46 LEQMSFKLSKRKVDENLQALHTILFGRKANAHYLKRNISQFSGFVWTSDEEKQKTK 213 + +SFKLSKRKVDENLQ+LHT+L+GRK+N H+LKRNISQFSGFVWT ++EKQ+ + Sbjct: 113 IPNVSFKLSKRKVDENLQSLHTVLYGRKSNNHFLKRNISQFSGFVWTDNQEKQRNR 168 >ref|NP_001147923.1| dek protein [Zea mays] gi|195614608|gb|ACG29134.1| dek protein [Zea mays] Length = 484 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/56 (69%), Positives = 50/56 (89%) Frame = +1 Query: 46 LEQMSFKLSKRKVDENLQALHTILFGRKANAHYLKRNISQFSGFVWTSDEEKQKTK 213 + +SFKLSKRK DE+LQ+LHT+L+GRK+N H+LKRNISQFSGFVWT ++EK +TK Sbjct: 91 IPNVSFKLSKRKADESLQSLHTVLYGRKSNNHFLKRNISQFSGFVWTDNQEKHRTK 146 >gb|EEC72065.1| hypothetical protein OsI_04995 [Oryza sativa Indica Group] Length = 509 Score = 88.6 bits (218), Expect = 5e-16 Identities = 37/56 (66%), Positives = 49/56 (87%) Frame = +1 Query: 46 LEQMSFKLSKRKVDENLQALHTILFGRKANAHYLKRNISQFSGFVWTSDEEKQKTK 213 + + FKLSKRK DENLQ+LH +++GRK+N H+LKRNISQFSGFVWT ++EKQ+T+ Sbjct: 103 IPNIQFKLSKRKADENLQSLHVLMYGRKSNVHFLKRNISQFSGFVWTDNQEKQRTR 158