BLASTX nr result
ID: Dioscorea21_contig00018683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00018683 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635354.1| PREDICTED: uncharacterized protein LOC100854... 59 5e-07 ref|XP_002515373.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_003635354.1| PREDICTED: uncharacterized protein LOC100854728 [Vitis vinifera] Length = 2807 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/85 (41%), Positives = 45/85 (52%), Gaps = 1/85 (1%) Frame = +3 Query: 201 ILQYSRLKRFVG-APTKEVGSTSDFINQNPVLHPTAILNHREILRKGKPVQQVLVQWGDK 377 + S LK F G P K + + +P+L P AI R ILR+GK VQQ+LVQW Sbjct: 1230 VFHISALKPFRGPVPDKVYPLPTATMGIHPLLVPAAICAVRTILRQGKEVQQILVQWTAS 1289 Query: 378 QEEDEKWEDVSEFQKNFPGLTLEDK 452 E+ WED F + +P LEDK Sbjct: 1290 DPENATWEDFVAFCRLYPDYHLEDK 1314 >ref|XP_002515373.1| conserved hypothetical protein [Ricinus communis] gi|223545317|gb|EEF46822.1| conserved hypothetical protein [Ricinus communis] Length = 121 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = +3 Query: 303 AILNHREILRKGKPVQQVLVQWGDKQEEDEKWEDVSEFQKNFPGLTLEDK 452 AILN RE++RK + QVLVQW + + ED KWED+ + FP L LEDK Sbjct: 27 AILNTRELVRKKSMIPQVLVQWANLRPEDAKWEDMQFLKAQFPDLVLEDK 76