BLASTX nr result
ID: Dioscorea21_contig00018541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00018541 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612193.1| hypothetical protein MTR_5g022380 [Medicago ... 58 7e-07 >ref|XP_003612193.1| hypothetical protein MTR_5g022380 [Medicago truncatula] gi|355513528|gb|AES95151.1| hypothetical protein MTR_5g022380 [Medicago truncatula] Length = 537 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +2 Query: 35 PELDLEVRIEEPLLIEKENEKGKEKAVIIPEDEEKRQPSIGEEHTIFEALRTVDFW 202 P +D E + EPLL +K +E+ +E E E KR+P IGEEHTI E ++T+DFW Sbjct: 268 PSVDKEKEVHEPLLAQKVSEEKEETRTKEEEVEIKRKPVIGEEHTIIEMVKTIDFW 323