BLASTX nr result
ID: Dioscorea21_contig00017499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00017499 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142210.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 gb|AGG38110.1| maternal effect embryo arrest 40 protein [Dimocar... 82 3e-14 ref|XP_002305565.1| predicted protein [Populus trichocarpa] gi|2... 80 1e-13 ref|XP_002272943.1| PREDICTED: pentatricopeptide repeat-containi... 80 1e-13 ref|XP_002531339.1| pentatricopeptide repeat-containing protein,... 80 2e-13 >ref|XP_004142210.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Cucumis sativus] gi|449525343|ref|XP_004169677.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Cucumis sativus] Length = 768 Score = 95.5 bits (236), Expect = 4e-18 Identities = 44/75 (58%), Positives = 57/75 (76%) Frame = +2 Query: 5 LIHQVPPDFTPKDLLSILRRQKDPSSAVHLLNWASKQGNFSPNLSFYEEILQILGKAGFF 184 ++H +PPDFTPK L+ LRRQ D +A+ + NWASKQ NF P+ S YEEIL+ LGKAG F Sbjct: 54 IVHHLPPDFTPKQLIETLRRQTDEVAALRVFNWASKQPNFVPSSSVYEEILRKLGKAGSF 113 Query: 185 DDMKLVLKEMQTSGC 229 + M+ VL+EM+ SGC Sbjct: 114 EYMRRVLEEMKLSGC 128 >gb|AGG38110.1| maternal effect embryo arrest 40 protein [Dimocarpus longan] Length = 763 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/73 (50%), Positives = 52/73 (71%) Frame = +2 Query: 11 HQVPPDFTPKDLLSILRRQKDPSSAVHLLNWASKQGNFSPNLSFYEEILQILGKAGFFDD 190 +Q+PP+FT L +RRQ D +SA+ L +WASKQ N++P LS YEE+L LGK G FD Sbjct: 53 YQLPPNFTSSQHLDTIRRQHDETSALRLFSWASKQPNYTPTLSVYEELLAKLGKVGSFDS 112 Query: 191 MKLVLKEMQTSGC 229 M +L+E++ +GC Sbjct: 113 MTEILQEIKAAGC 125 >ref|XP_002305565.1| predicted protein [Populus trichocarpa] gi|222848529|gb|EEE86076.1| predicted protein [Populus trichocarpa] Length = 757 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/70 (54%), Positives = 51/70 (72%) Frame = +2 Query: 14 QVPPDFTPKDLLSILRRQKDPSSAVHLLNWASKQGNFSPNLSFYEEILQILGKAGFFDDM 193 ++ P+FTP LL LRR++D S+ +HL WASKQ NF P+ S ++E+L LGKAG FD M Sbjct: 49 RLSPNFTPTQLLHSLRREEDSSAVIHLFYWASKQPNFKPSSSIFKEVLHKLGKAGEFDAM 108 Query: 194 KLVLKEMQTS 223 K +LKEM+ S Sbjct: 109 KDILKEMKIS 118 >ref|XP_002272943.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Vitis vinifera] Length = 772 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/72 (54%), Positives = 50/72 (69%) Frame = +2 Query: 14 QVPPDFTPKDLLSILRRQKDPSSAVHLLNWASKQGNFSPNLSFYEEILQILGKAGFFDDM 193 Q+P +FTPK L LRRQ D S + LL+WASKQ NF P+ YEE+L+ LGK G F M Sbjct: 65 QLPQNFTPKQLRDALRRQSDEDSILDLLDWASKQPNFVPSSVIYEEVLRKLGKDGSFGSM 124 Query: 194 KLVLKEMQTSGC 229 + VL+EM+ +GC Sbjct: 125 RRVLQEMKHTGC 136 >ref|XP_002531339.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529061|gb|EEF31046.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 630 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/68 (57%), Positives = 49/68 (72%) Frame = +2 Query: 26 DFTPKDLLSILRRQKDPSSAVHLLNWASKQGNFSPNLSFYEEILQILGKAGFFDDMKLVL 205 +FTP LL LRRQ D ++A+ LL+WASKQ NF PN S YEEIL+ LGK G F+ MK +L Sbjct: 51 NFTPAQLLDTLRRQNDETAALRLLSWASKQPNFRPNSSIYEEILRKLGKVGSFNSMKDIL 110 Query: 206 KEMQTSGC 229 +EM+ C Sbjct: 111 QEMKGLDC 118