BLASTX nr result
ID: Dioscorea21_contig00017419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00017419 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157148.1| PREDICTED: tryptophan synthase beta chain 2,... 118 4e-25 ref|XP_004142558.1| PREDICTED: tryptophan synthase beta chain 2,... 118 4e-25 ref|XP_003519001.1| PREDICTED: tryptophan synthase beta chain 2,... 113 1e-23 ref|NP_200292.1| tryptophan synthase beta chain [Arabidopsis tha... 113 2e-23 ref|XP_002523007.1| tryptophan synthase beta chain, putative [Ri... 113 2e-23 >ref|XP_004157148.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Cucumis sativus] Length = 472 Score = 118 bits (296), Expect = 4e-25 Identities = 60/81 (74%), Positives = 68/81 (83%) Frame = -1 Query: 243 VSCTLTRDPFTMNSAPTGANAGLALRPDSFGRFGRFGGKYVPETLMHALTELESAFKSLS 64 VSCTLTR+P ++ ++ L RPDSFGRFGRFGGKYVPETLMHALTELE+AF SL+ Sbjct: 52 VSCTLTREP-SLAMEDKVHDSSLQQRPDSFGRFGRFGGKYVPETLMHALTELETAFYSLA 110 Query: 63 QDQDFQKELDGILKDYVGRES 1 DQDFQKELDGIL+DYVGRES Sbjct: 111 GDQDFQKELDGILRDYVGRES 131 >ref|XP_004142558.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Cucumis sativus] Length = 472 Score = 118 bits (296), Expect = 4e-25 Identities = 60/81 (74%), Positives = 68/81 (83%) Frame = -1 Query: 243 VSCTLTRDPFTMNSAPTGANAGLALRPDSFGRFGRFGGKYVPETLMHALTELESAFKSLS 64 VSCTLTR+P ++ ++ L RPDSFGRFGRFGGKYVPETLMHALTELE+AF SL+ Sbjct: 52 VSCTLTREP-SLAMEDKVHDSSLQQRPDSFGRFGRFGGKYVPETLMHALTELETAFYSLA 110 Query: 63 QDQDFQKELDGILKDYVGRES 1 DQDFQKELDGIL+DYVGRES Sbjct: 111 GDQDFQKELDGILRDYVGRES 131 >ref|XP_003519001.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Glycine max] Length = 479 Score = 113 bits (283), Expect = 1e-23 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 4/85 (4%) Frame = -1 Query: 243 VSCTLTRDPFTM----NSAPTGANAGLALRPDSFGRFGRFGGKYVPETLMHALTELESAF 76 VSC+LT+DP+++ + + L RPDSFGRFG+FGGKYVPETLMHALTELE+AF Sbjct: 54 VSCSLTKDPYSVVPLEEHSKMDNGSVLLQRPDSFGRFGKFGGKYVPETLMHALTELEAAF 113 Query: 75 KSLSQDQDFQKELDGILKDYVGRES 1 SLS D++FQKEL GILKDYVGRES Sbjct: 114 YSLSADEEFQKELAGILKDYVGRES 138 >ref|NP_200292.1| tryptophan synthase beta chain [Arabidopsis thaliana] gi|136251|sp|P14671.1|TRPB1_ARATH RecName: Full=Tryptophan synthase beta chain 1, chloroplastic; Flags: Precursor gi|14194117|gb|AAK56253.1|AF367264_1 AT5g54810/MBG8_7 [Arabidopsis thaliana] gi|166892|gb|AAA32878.1| tryptophan synthase beta subunit [Arabidopsis thaliana] gi|9758261|dbj|BAB08760.1| tryptophan synthase beta chain 1 precursor [Arabidopsis thaliana] gi|21592983|gb|AAM64932.1| tryptophan synthase beta chain 1 precursor [Arabidopsis thaliana] gi|22137210|gb|AAM91450.1| AT5g54810/MBG8_7 [Arabidopsis thaliana] gi|110742593|dbj|BAE99210.1| tryptophan synthase beta chain 1 precursor [Arabidopsis thaliana] gi|332009160|gb|AED96543.1| tryptophan synthase beta chain [Arabidopsis thaliana] Length = 470 Score = 113 bits (282), Expect = 2e-23 Identities = 56/81 (69%), Positives = 67/81 (82%) Frame = -1 Query: 243 VSCTLTRDPFTMNSAPTGANAGLALRPDSFGRFGRFGGKYVPETLMHALTELESAFKSLS 64 VSCT+ +DP + +A G++ L RPDSFGRFG+FGGKYVPETLMHAL+ELESAF +L+ Sbjct: 51 VSCTIAKDPPVLMAA--GSDPALWQRPDSFGRFGKFGGKYVPETLMHALSELESAFYALA 108 Query: 63 QDQDFQKELDGILKDYVGRES 1 D DFQ+EL GILKDYVGRES Sbjct: 109 TDDDFQRELAGILKDYVGRES 129 >ref|XP_002523007.1| tryptophan synthase beta chain, putative [Ricinus communis] gi|223537819|gb|EEF39437.1| tryptophan synthase beta chain, putative [Ricinus communis] Length = 394 Score = 113 bits (282), Expect = 2e-23 Identities = 58/83 (69%), Positives = 65/83 (78%), Gaps = 2/83 (2%) Frame = -1 Query: 243 VSCTLTRDPFT--MNSAPTGANAGLALRPDSFGRFGRFGGKYVPETLMHALTELESAFKS 70 VSCTLTR+ M G++ L RPDSFGRFG+FGGKYVPETLM+AL+ELESAF S Sbjct: 52 VSCTLTREASAVKMEEEKEGSDPALWQRPDSFGRFGQFGGKYVPETLMYALSELESAFHS 111 Query: 69 LSQDQDFQKELDGILKDYVGRES 1 L D DFQKELDGILKDYVGRE+ Sbjct: 112 LKDDLDFQKELDGILKDYVGRET 134