BLASTX nr result
ID: Dioscorea21_contig00017193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00017193 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529933.1| PREDICTED: uncharacterized protein LOC100777... 86 2e-15 ref|XP_003622497.1| Transmembrane protein 8B [Medicago truncatul... 86 2e-15 emb|CBI40437.3| unnamed protein product [Vitis vinifera] 86 2e-15 ref|XP_002276054.1| PREDICTED: uncharacterized protein LOC100258... 85 7e-15 ref|XP_002511889.1| conserved hypothetical protein [Ricinus comm... 84 2e-14 >ref|XP_003529933.1| PREDICTED: uncharacterized protein LOC100777848 [Glycine max] Length = 825 Score = 86.3 bits (212), Expect = 2e-15 Identities = 37/67 (55%), Positives = 51/67 (76%) Frame = -1 Query: 234 LSSYSHPETWLRPYDWAYLRVDLPPWFSSMVVTFVSNVNIDKDSARLVPKSKLPVICLKS 55 LSS+S+P+T LRPYD Y+RVD+PPWFS++ ++ S+V++D VPKS LP+IC + Sbjct: 49 LSSFSYPQTTLRPYDLLYIRVDIPPWFSAVSISLNSDVDLDVSRVERVPKSSLPLICFRD 108 Query: 54 GSPPLLD 34 GSPPL D Sbjct: 109 GSPPLPD 115 >ref|XP_003622497.1| Transmembrane protein 8B [Medicago truncatula] gi|355497512|gb|AES78715.1| Transmembrane protein 8B [Medicago truncatula] Length = 839 Score = 86.3 bits (212), Expect = 2e-15 Identities = 36/67 (53%), Positives = 51/67 (76%) Frame = -1 Query: 234 LSSYSHPETWLRPYDWAYLRVDLPPWFSSMVVTFVSNVNIDKDSARLVPKSKLPVICLKS 55 +SS+S+P+T LRPYD+ Y+RVD+PPWFS++ + S+V++D VPKS LP+IC + Sbjct: 50 VSSFSYPQTTLRPYDFRYIRVDIPPWFSAVSIALNSDVDLDVSRIERVPKSSLPIICFRD 109 Query: 54 GSPPLLD 34 GSPPL D Sbjct: 110 GSPPLPD 116 >emb|CBI40437.3| unnamed protein product [Vitis vinifera] Length = 805 Score = 86.3 bits (212), Expect = 2e-15 Identities = 39/78 (50%), Positives = 56/78 (71%) Frame = -1 Query: 234 LSSYSHPETWLRPYDWAYLRVDLPPWFSSMVVTFVSNVNIDKDSARLVPKSKLPVICLKS 55 +SS S+ +T L+PY+W Y+RV+LP WFSSM + S+V+I +S +PKS LP+IC ++ Sbjct: 28 VSSISYSKTKLKPYEWRYIRVELPLWFSSMSIALESDVDIGTESTGKIPKSTLPMICFRN 87 Query: 54 GSPPLLDISGIYPTDLLL 1 GSPPL D+S DL+L Sbjct: 88 GSPPLPDVSNTTVKDLVL 105 >ref|XP_002276054.1| PREDICTED: uncharacterized protein LOC100258534 [Vitis vinifera] Length = 823 Score = 84.7 bits (208), Expect = 7e-15 Identities = 38/77 (49%), Positives = 55/77 (71%) Frame = -1 Query: 234 LSSYSHPETWLRPYDWAYLRVDLPPWFSSMVVTFVSNVNIDKDSARLVPKSKLPVICLKS 55 +SS S+ +T L+PY+W Y+RV+LP WFSSM + S+V+I +S +PKS LP+IC ++ Sbjct: 28 VSSISYSKTKLKPYEWRYIRVELPLWFSSMSIALESDVDIGTESTGKIPKSTLPMICFRN 87 Query: 54 GSPPLLDISGIYPTDLL 4 GSPPL D+S DL+ Sbjct: 88 GSPPLPDVSNTTVKDLV 104 >ref|XP_002511889.1| conserved hypothetical protein [Ricinus communis] gi|223549069|gb|EEF50558.1| conserved hypothetical protein [Ricinus communis] Length = 803 Score = 83.6 bits (205), Expect = 2e-14 Identities = 36/68 (52%), Positives = 51/68 (75%) Frame = -1 Query: 234 LSSYSHPETWLRPYDWAYLRVDLPPWFSSMVVTFVSNVNIDKDSARLVPKSKLPVICLKS 55 +SS+ +P++ ++PYD Y+RVDLPPWFSSM + S+V++D S VPKS LP+IC + Sbjct: 44 VSSFRYPKSVVKPYDLRYIRVDLPPWFSSMSIAVESDVDLDAKSISKVPKSTLPMICFRD 103 Query: 54 GSPPLLDI 31 GSPPL D+ Sbjct: 104 GSPPLPDV 111