BLASTX nr result
ID: Dioscorea21_contig00016394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016394 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB89041.1| glutathione reductase [Vigna unguiculata] 55 5e-06 gb|ABF29525.1| dual-targeted glutathione reductase [Phaseolus vu... 55 6e-06 gb|AFS30566.1| glutathione reductase [Dimocarpus longan] 55 8e-06 gb|AFF18772.2| glutathione reductase [Dimocarpus longan] 55 8e-06 >gb|ABB89041.1| glutathione reductase [Vigna unguiculata] Length = 518 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -3 Query: 225 GIHPTSAEEFVTMRSPTRKIRRSLASEGKTEEIKSAA 115 GIHP++AEEFVTMR+PTR+IR+S +SEGK+ +K+ A Sbjct: 480 GIHPSAAEEFVTMRTPTRRIRKSQSSEGKSGSVKATA 516 >gb|ABF29525.1| dual-targeted glutathione reductase [Phaseolus vulgaris] Length = 550 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/38 (68%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = -3 Query: 225 GIHPTSAEEFVTMRSPTRKIRRSLASEGKT-EEIKSAA 115 GIHP++AEEFVTMR+PTRKIR+S +SEGK+ ++K+AA Sbjct: 511 GIHPSAAEEFVTMRTPTRKIRKSQSSEGKSGSDVKAAA 548 >gb|AFS30566.1| glutathione reductase [Dimocarpus longan] Length = 553 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/38 (71%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -3 Query: 225 GIHPTSAEEFVTMRSPTRKIRRSLASEGKTE-EIKSAA 115 GIHPT+AEEFVTMR+PTRKIR+ SEG T+ E+K+AA Sbjct: 514 GIHPTAAEEFVTMRTPTRKIRQDPPSEGMTDPEVKAAA 551 >gb|AFF18772.2| glutathione reductase [Dimocarpus longan] Length = 553 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/38 (71%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -3 Query: 225 GIHPTSAEEFVTMRSPTRKIRRSLASEGKTE-EIKSAA 115 GIHPT+AEEFVTMR+PTRKIR+ SEG T+ E+K+AA Sbjct: 514 GIHPTAAEEFVTMRTPTRKIRQDPPSEGMTDPEVKAAA 551