BLASTX nr result
ID: Dioscorea21_contig00016338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00016338 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511378.1| anthranilate phosphoribosyltransferase, puta... 59 5e-07 ref|XP_002871793.1| hypothetical protein ARALYDRAFT_909800 [Arab... 55 4e-06 gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidops... 55 6e-06 ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransf... 55 6e-06 ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabido... 55 6e-06 >ref|XP_002511378.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] gi|223550493|gb|EEF51980.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] Length = 425 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = -1 Query: 313 AALLVSGHVSSLAEGVVWAREVQQSGRAVEVLDSWMHLSNKLRGD 179 AALLVSG S+LAEGV ARE Q SG+A++ +DSW+++SNK++G+ Sbjct: 378 AALLVSGCASTLAEGVGMARETQLSGKAMKTIDSWINISNKMKGE 422 >ref|XP_002871793.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. lyrata] gi|297317630|gb|EFH48052.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. lyrata] Length = 444 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 313 AALLVSGHVSSLAEGVVWAREVQQSGRAVEVLDSWMHLSN 194 AALLVS V +LAEGV AREVQ SG+A++ LDSW+++SN Sbjct: 399 AALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWINISN 438 >gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|28394222|gb|AAO42464.1| phosphorybosyl anthranilate transferase 1 [Arabidopsis thaliana] Length = 441 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 313 AALLVSGHVSSLAEGVVWAREVQQSGRAVEVLDSWMHLSN 194 AALLVS V +LAEGV AREVQ SG+A++ LDSW+++SN Sbjct: 396 AALLVSNRVQTLAEGVTVAREVQSSGKAIKTLDSWINISN 435 >ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|297733759|emb|CBI15006.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -1 Query: 313 AALLVSGHVSSLAEGVVWAREVQQSGRAVEVLDSWMHLSNKLR 185 AALLVSG V++LA+GV ARE Q+SG+A++ LD W+ +SNK + Sbjct: 346 AALLVSGRVNTLADGVSLARETQESGKAIKTLDLWIEISNKAK 388 >ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana] gi|401213|sp|Q02166.1|TRPD_ARATH RecName: Full=Anthranilate phosphoribosyltransferase, chloroplastic; Flags: Precursor gi|166792|gb|AAA32835.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|9757891|dbj|BAB08398.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|15450852|gb|AAK96697.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|20259900|gb|AAM13297.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|332005110|gb|AED92493.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana] gi|445600|prf||1909347A phosphoribosylanthranilate transferase Length = 444 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 313 AALLVSGHVSSLAEGVVWAREVQQSGRAVEVLDSWMHLSN 194 AALLVS V +LAEGV AREVQ SG+A++ LDSW+++SN Sbjct: 399 AALLVSNRVQTLAEGVTVAREVQSSGKAIKTLDSWINISN 438