BLASTX nr result
ID: Dioscorea21_contig00013376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00013376 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515338.1| ring finger protein, putative [Ricinus commu... 60 2e-07 >ref|XP_002515338.1| ring finger protein, putative [Ricinus communis] gi|223545282|gb|EEF46787.1| ring finger protein, putative [Ricinus communis] Length = 554 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 2/71 (2%) Frame = +3 Query: 21 MDVYLRRTAGN-IGSSRKGSNLVGRDP-KHEDKSIQHCNRIGCSTNLNYMKGGHLSNANK 194 MD Y + AG+ + SRKGS+++ RD + D++ Q CNRIGCS LN KG +S + K Sbjct: 1 MDEYSGKKAGDGLAVSRKGSSIILRDTANNRDRNAQFCNRIGCSGRLNSAKGTQISCSEK 60 Query: 195 SNCSRSSFRSA 227 + SR SFRS+ Sbjct: 61 AKSSRPSFRSS 71