BLASTX nr result
ID: Dioscorea21_contig00013338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00013338 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134345.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 emb|CBI38862.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002273719.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_002320730.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002511731.1| pentatricopeptide repeat-containing protein,... 61 8e-08 >ref|XP_004134345.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Cucumis sativus] gi|449480346|ref|XP_004155867.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Cucumis sativus] Length = 404 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = +2 Query: 185 KWVDIGPNITEAQKQAISQLPPKMIRRCKALMKRIICFSPKDEIMSILL 331 +WV++G +ITE QKQAISQLPPKM +RCKA+MK+IICFSP+ +S +L Sbjct: 67 RWVEVGYDITETQKQAISQLPPKMTKRCKAVMKQIICFSPQKGELSDML 115 >emb|CBI38862.3| unnamed protein product [Vitis vinifera] Length = 353 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +2 Query: 185 KWVDIGPNITEAQKQAISQLPPKMIRRCKALMKRIICFSPKDEIMSILL 331 KW++IGPNITEAQK ISQ+ KM +RCKAL+K+IICFSP++ +S LL Sbjct: 10 KWIEIGPNITEAQKMTISQISLKMTKRCKALVKQIICFSPEERSLSDLL 58 >ref|XP_002273719.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Vitis vinifera] Length = 352 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +2 Query: 185 KWVDIGPNITEAQKQAISQLPPKMIRRCKALMKRIICFSPKDEIMSILL 331 KW++IGPNITEAQK ISQ+ KM +RCKAL+K+IICFSP++ +S LL Sbjct: 10 KWIEIGPNITEAQKMTISQISLKMTKRCKALVKQIICFSPEERSLSDLL 58 >ref|XP_002320730.1| predicted protein [Populus trichocarpa] gi|222861503|gb|EEE99045.1| predicted protein [Populus trichocarpa] Length = 407 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 185 KWVDIGPNITEAQKQAISQLPPKMIRRCKALMKRIICFSPK 307 +WV+IGPNI E QKQAISQLP KM +RCKALM++IICF+ K Sbjct: 74 RWVEIGPNIPEEQKQAISQLPFKMTKRCKALMRQIICFNDK 114 >ref|XP_002511731.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548911|gb|EEF50400.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 244 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +2 Query: 185 KWVDIGPNITEAQKQAISQLPPKMIRRCKALMKRIICFS 301 KW +IGPNIT++Q+QAIS+LPPKM RCK L+ +IIC S Sbjct: 73 KWAEIGPNITKSQQQAISELPPKMTNRCKTLVTQIICSS 111