BLASTX nr result
ID: Dioscorea21_contig00013318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00013318 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW85307.1| ATPase, coupled to transmembrane movement of subs... 75 7e-12 ref|NP_001152544.1| ATPase, coupled to transmembrane movement of... 75 7e-12 ref|XP_004170745.1| PREDICTED: ABC transporter G family member 8... 73 2e-11 ref|XP_004140744.1| PREDICTED: ABC transporter G family member 8... 73 2e-11 gb|EEC80691.1| hypothetical protein OsI_23116 [Oryza sativa Indi... 72 5e-11 >gb|AFW85307.1| ATPase, coupled to transmembrane movement of substance [Zea mays] Length = 618 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +3 Query: 3 VVPSGAGKSTLLDILSARTSPTSGHLFLNSTPLRPSLFRRISSHAPNTN 149 V PSGAGKSTLLDIL+ART+PT G L LNS PLRPS FRR+SSH P + Sbjct: 84 VGPSGAGKSTLLDILAARTAPTHGRLLLNSAPLRPSSFRRLSSHVPQAD 132 >ref|NP_001152544.1| ATPase, coupled to transmembrane movement of substances [Zea mays] gi|195657369|gb|ACG48152.1| ATPase, coupled to transmembrane movement of substances [Zea mays] Length = 618 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +3 Query: 3 VVPSGAGKSTLLDILSARTSPTSGHLFLNSTPLRPSLFRRISSHAPNTN 149 V PSGAGKSTLLDIL+ART+PT G L LNS PLRPS FRR+SSH P + Sbjct: 84 VGPSGAGKSTLLDILAARTAPTHGRLLLNSAPLRPSSFRRLSSHVPQAD 132 >ref|XP_004170745.1| PREDICTED: ABC transporter G family member 8-like [Cucumis sativus] Length = 607 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +3 Query: 3 VVPSGAGKSTLLDILSARTSPTSGHLFLNSTPLRPSLFRRISSHAP 140 V PSGAGKSTLLDILSARTSPT G LFLNS+PL PS FR++S++ P Sbjct: 77 VGPSGAGKSTLLDILSARTSPTQGSLFLNSSPLNPSTFRKLSAYVP 122 >ref|XP_004140744.1| PREDICTED: ABC transporter G family member 8-like [Cucumis sativus] Length = 607 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +3 Query: 3 VVPSGAGKSTLLDILSARTSPTSGHLFLNSTPLRPSLFRRISSHAP 140 V PSGAGKSTLLDILSARTSPT G LFLNS+PL PS FR++S++ P Sbjct: 77 VGPSGAGKSTLLDILSARTSPTQGSLFLNSSPLNPSTFRKLSAYVP 122 >gb|EEC80691.1| hypothetical protein OsI_23116 [Oryza sativa Indica Group] Length = 598 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +3 Query: 3 VVPSGAGKSTLLDILSARTSPTSGHLFLNSTPLRPSLFRRISSHAP 140 V PSGAGKSTLLDIL+ART+PT G L LN+ PLRPS FRR+S+H P Sbjct: 95 VGPSGAGKSTLLDILAARTAPTHGRLLLNAAPLRPSSFRRLSAHVP 140