BLASTX nr result
ID: Dioscorea21_contig00013086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00013086 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606382.1| UDP rhamnose anthocyanidin-3-glucoside rhamn... 56 3e-06 >ref|XP_003606382.1| UDP rhamnose anthocyanidin-3-glucoside rhamnosyltransferase [Medicago truncatula] gi|355507437|gb|AES88579.1| UDP rhamnose anthocyanidin-3-glucoside rhamnosyltransferase [Medicago truncatula] Length = 375 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/66 (43%), Positives = 45/66 (68%), Gaps = 6/66 (9%) Frame = +1 Query: 1 VERDGENGMFTREGVRDAVTKVM-EDDK-----VKERKRKWKEFLVDEKVQGMFMTRLVE 162 V+R+ E+G F +EG+ +AV VM E DK ++E KW+EFL+D+++Q F+T LV Sbjct: 310 VKRNDEDGFFEKEGILEAVKGVMVEVDKEPGKQIRENHMKWREFLLDKEIQNKFITDLVA 369 Query: 163 ELKEMV 180 +LK +V Sbjct: 370 QLKSLV 375