BLASTX nr result
ID: Dioscorea21_contig00013047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00013047 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552276.1| PREDICTED: probable inactive leucine-rich re... 69 3e-10 ref|XP_003529180.1| PREDICTED: probable inactive leucine-rich re... 68 7e-10 ref|XP_002315618.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 tpg|DAA38853.1| TPA: putative leucine-rich repat protein kinase ... 67 2e-09 ref|XP_004159709.1| PREDICTED: probable inactive leucine-rich re... 67 2e-09 >ref|XP_003552276.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830-like [Glycine max] Length = 706 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 2 HPNIVRLRAYYWAQDEKLLITDFISNGNLATALR 103 HPNIVRLRAYYWA DEKLLI+DFISNGNLATALR Sbjct: 463 HPNIVRLRAYYWAPDEKLLISDFISNGNLATALR 496 >ref|XP_003529180.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830-like [Glycine max] Length = 706 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 HPNIVRLRAYYWAQDEKLLITDFISNGNLATALR 103 HPNIV+LRAYYWA DEKLLI+DFISNGNLATALR Sbjct: 463 HPNIVKLRAYYWAPDEKLLISDFISNGNLATALR 496 >ref|XP_002315618.1| predicted protein [Populus trichocarpa] gi|222864658|gb|EEF01789.1| predicted protein [Populus trichocarpa] Length = 532 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 2 HPNIVRLRAYYWAQDEKLLITDFISNGNLATALRATFS 115 HPN+V+LRAYYWA DEKLLI+DFISNGNLA ALR +S Sbjct: 485 HPNVVKLRAYYWAPDEKLLISDFISNGNLANALRGLYS 522 >tpg|DAA38853.1| TPA: putative leucine-rich repat protein kinase family protein [Zea mays] Length = 744 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +2 Query: 2 HPNIVRLRAYYWAQDEKLLITDFISNGNLATALR 103 HPNIVRLRAYYW+ DEKL+ITDF++NGNLATALR Sbjct: 480 HPNIVRLRAYYWSADEKLVITDFVNNGNLATALR 513 >ref|XP_004159709.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830-like [Cucumis sativus] Length = 694 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 2 HPNIVRLRAYYWAQDEKLLITDFISNGNLATALR 103 HPNIV+LRAYYWA DEKLLI+DFISNGNLA+ALR Sbjct: 449 HPNIVKLRAYYWAPDEKLLISDFISNGNLASALR 482