BLASTX nr result
ID: Dioscorea21_contig00013010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00013010 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160023.1| PREDICTED: uncharacterized LOC101217702 [Cuc... 54 1e-05 >ref|XP_004160023.1| PREDICTED: uncharacterized LOC101217702 [Cucumis sativus] Length = 853 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 341 CSDQTLFSSEEEGNEQCTGYGEITLSWLGRFK 246 CSDQTLFSSEEEG QCTG GEI LSW R + Sbjct: 805 CSDQTLFSSEEEGEGQCTGSGEIKLSWFNRLR 836