BLASTX nr result
ID: Dioscorea21_contig00012685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00012685 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19591.3| unnamed protein product [Vitis vinifera] 62 4e-08 ref|XP_003589266.1| B3 domain-containing protein [Medicago trunc... 58 9e-07 ref|XP_002510291.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_003549416.1| PREDICTED: B3 domain-containing protein Os01... 55 8e-06 >emb|CBI19591.3| unnamed protein product [Vitis vinifera] Length = 604 Score = 62.4 bits (150), Expect = 4e-08 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = -2 Query: 161 RSPHFFKIFMPQLHSQQLVVPSGFLKHMEGDLAETLSLIGPSGNQWDVNLMKR 3 + PHFF++F P S++L +PS F+KHMEG + +SL+GPS N W V+L+++ Sbjct: 5 KRPHFFEVFQPDASSERLKIPSRFIKHMEGRTSGFVSLVGPSDNTWHVDLIQQ 57 >ref|XP_003589266.1| B3 domain-containing protein [Medicago truncatula] gi|355478314|gb|AES59517.1| B3 domain-containing protein [Medicago truncatula] Length = 596 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/53 (49%), Positives = 33/53 (62%) Frame = -2 Query: 161 RSPHFFKIFMPQLHSQQLVVPSGFLKHMEGDLAETLSLIGPSGNQWDVNLMKR 3 R PHF+ +F P SQ L VP GF+ MEG +SL GPSGN W V L+++ Sbjct: 12 RKPHFYHLFNPSSTSQSLRVPDGFVHQMEGATCGLVSLTGPSGNTWQVRLVEQ 64 >ref|XP_002510291.1| conserved hypothetical protein [Ricinus communis] gi|223550992|gb|EEF52478.1| conserved hypothetical protein [Ricinus communis] Length = 567 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/53 (47%), Positives = 37/53 (69%) Frame = -2 Query: 161 RSPHFFKIFMPQLHSQQLVVPSGFLKHMEGDLAETLSLIGPSGNQWDVNLMKR 3 R P FF+IF L S +L +P+ F +H+EG + ++SL GPSGN W VNL+++ Sbjct: 14 RRPCFFEIFSSNLSSDRLRIPARFTRHLEGRTSGSVSLTGPSGNIWTVNLIQQ 66 >ref|XP_003549416.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Glycine max] Length = 561 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/53 (43%), Positives = 34/53 (64%) Frame = -2 Query: 161 RSPHFFKIFMPQLHSQQLVVPSGFLKHMEGDLAETLSLIGPSGNQWDVNLMKR 3 R PHF++++ S +L +P GF+ HMEG ++SL GPSG W V L+K+ Sbjct: 2 RKPHFYEVYSSAFSSHRLKLPDGFVCHMEGRTYGSVSLTGPSGKTWTVQLIKQ 54